Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   NY40_RS03260 Genome accession   NZ_AP014523
Coordinates   643364..643477 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori NY40     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 638364..648477
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NY40_RS03235 (NY40_0648) - 638417..640642 (+) 2226 WP_041050387.1 AAA family ATPase -
  NY40_RS03240 (NY40_0649) panD 640632..640985 (+) 354 WP_041050389.1 aspartate 1-decarboxylase -
  NY40_RS03245 (NY40_0650) - 640988..641281 (+) 294 WP_000347917.1 YbaB/EbfC family nucleoid-associated protein -
  NY40_RS03250 (NY40_0651) - 641281..642285 (+) 1005 WP_041050391.1 PDZ domain-containing protein -
  NY40_RS03255 (NY40_0652) comB6 642293..643348 (+) 1056 WP_041050393.1 P-type conjugative transfer protein TrbL Machinery gene
  NY40_RS03260 comB7 643364..643477 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  NY40_RS03265 (NY40_0653) comB8 643474..644211 (+) 738 WP_021177589.1 type IV secretion system protein Machinery gene
  NY40_RS03270 (NY40_0654) comB9 644211..645194 (+) 984 WP_041050396.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  NY40_RS03275 (NY40_0655) comB10 645187..646317 (+) 1131 WP_021177591.1 DNA type IV secretion system protein ComB10 Machinery gene
  NY40_RS03280 (NY40_0656) - 646387..647805 (+) 1419 WP_041050398.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=65785 NY40_RS03260 WP_001217873.1 643364..643477(+) (comB7) [Helicobacter pylori NY40]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=65785 NY40_RS03260 WP_001217873.1 643364..643477(+) (comB7) [Helicobacter pylori NY40]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G2MCV1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment