Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | H020_RS0111465 | Genome accession | NZ_AKVY01000001 |
| Coordinates | 2160258..2160383 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae TIGR4 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2155258..2165383
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| H020_RS14460 | - | 2155597..2157199 (-) | 1603 | Protein_2127 | YhgE/Pip family protein | - |
| H020_RS0111440 | - | 2157378..2157920 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| H020_RS0111455 | comE | 2158163..2158915 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| H020_RS0111460 | comD/comD2 | 2158912..2160237 (-) | 1326 | WP_000364845.1 | competence system sensor histidine kinase ComD | Regulator |
| H020_RS0111465 | comC/comC2 | 2160258..2160383 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| H020_RS0111475 | rlmH | 2160665..2161144 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| H020_RS0111480 | htrA | 2161327..2162508 (+) | 1182 | WP_000681597.1 | S1C family serine protease | Regulator |
| H020_RS0111485 | spo0J | 2162566..2163324 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=64979 H020_RS0111465 WP_000799686.1 2160258..2160383(-) (comC/comC2) [Streptococcus pneumoniae TIGR4]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=64979 H020_RS0111465 WP_000799686.1 2160258..2160383(-) (comC/comC2) [Streptococcus pneumoniae TIGR4]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |