Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | LZT96_RS04900 | Genome accession | NZ_CP090941 |
| Coordinates | 1009466..1009897 (+) | Length | 143 a.a. |
| NCBI ID | WP_060555994.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis strain HAF242 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1000910..1046919 | 1009466..1009897 | within | 0 |
Gene organization within MGE regions
Location: 1000910..1046919
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LZT96_RS04785 (LZT96_04785) | - | 1000910..1001464 (+) | 555 | WP_002474678.1 | alpha/beta hydrolase | - |
| LZT96_RS04830 (LZT96_04830) | - | 1002662..1003222 (-) | 561 | WP_275044179.1 | site-specific integrase | - |
| LZT96_RS04835 (LZT96_04835) | - | 1003328..1003726 (-) | 399 | Protein_915 | phage integrase SAM-like domain-containing protein | - |
| LZT96_RS04840 (LZT96_04840) | - | 1003786..1004409 (-) | 624 | WP_060556002.1 | hypothetical protein | - |
| LZT96_RS04845 (LZT96_04845) | - | 1004411..1004914 (-) | 504 | WP_060556001.1 | hypothetical protein | - |
| LZT96_RS04850 (LZT96_04850) | - | 1004911..1005378 (-) | 468 | WP_060556000.1 | ImmA/IrrE family metallo-endopeptidase | - |
| LZT96_RS04855 (LZT96_04855) | - | 1005391..1005702 (-) | 312 | WP_053091513.1 | helix-turn-helix domain-containing protein | - |
| LZT96_RS04860 (LZT96_04860) | - | 1005870..1006088 (+) | 219 | WP_047499919.1 | hypothetical protein | - |
| LZT96_RS04865 (LZT96_04865) | - | 1006126..1006899 (+) | 774 | WP_151364290.1 | phage antirepressor | - |
| LZT96_RS12490 | - | 1006911..1007021 (+) | 111 | Protein_922 | DUF2829 domain-containing protein | - |
| LZT96_RS04870 (LZT96_04870) | - | 1007105..1007317 (+) | 213 | WP_060555997.1 | DUF771 domain-containing protein | - |
| LZT96_RS04875 (LZT96_04875) | - | 1007330..1007506 (+) | 177 | WP_203415625.1 | hypothetical protein | - |
| LZT96_RS04880 (LZT96_04880) | - | 1007569..1008339 (+) | 771 | WP_060555996.1 | hypothetical protein | - |
| LZT96_RS04885 (LZT96_04885) | - | 1008341..1008610 (+) | 270 | WP_060555995.1 | hypothetical protein | - |
| LZT96_RS04890 (LZT96_04890) | - | 1008588..1008839 (+) | 252 | WP_002485808.1 | hypothetical protein | - |
| LZT96_RS04895 (LZT96_04895) | - | 1008832..1009476 (+) | 645 | WP_002485844.1 | DUF1071 domain-containing protein | - |
| LZT96_RS04900 (LZT96_04900) | ssbA | 1009466..1009897 (+) | 432 | WP_060555994.1 | single-stranded DNA-binding protein | Machinery gene |
| LZT96_RS04905 (LZT96_04905) | - | 1009911..1010582 (+) | 672 | WP_060555993.1 | putative HNHc nuclease | - |
| LZT96_RS04910 (LZT96_04910) | - | 1010579..1011265 (+) | 687 | WP_060555992.1 | DnaD domain protein | - |
| LZT96_RS04915 (LZT96_04915) | - | 1011271..1011624 (+) | 354 | WP_060555991.1 | hypothetical protein | - |
| LZT96_RS04920 (LZT96_04920) | - | 1011614..1012861 (+) | 1248 | WP_060555990.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| LZT96_RS04925 (LZT96_04925) | - | 1012858..1013088 (+) | 231 | WP_049401348.1 | hypothetical protein | - |
| LZT96_RS04930 (LZT96_04930) | - | 1013057..1013281 (+) | 225 | WP_002456377.1 | DUF3269 family protein | - |
| LZT96_RS04935 (LZT96_04935) | - | 1013292..1013708 (+) | 417 | WP_060555989.1 | DUF1064 domain-containing protein | - |
| LZT96_RS04940 (LZT96_04940) | - | 1013695..1014117 (+) | 423 | WP_060555988.1 | hypothetical protein | - |
| LZT96_RS04945 (LZT96_04945) | - | 1014117..1014308 (+) | 192 | WP_060555987.1 | hypothetical protein | - |
| LZT96_RS04950 (LZT96_04950) | - | 1014309..1014722 (+) | 414 | WP_060555986.1 | SA1788 family PVL leukocidin-associated protein | - |
| LZT96_RS04955 (LZT96_04955) | - | 1014719..1015174 (+) | 456 | WP_060555985.1 | DUF3310 domain-containing protein | - |
| LZT96_RS04960 (LZT96_04960) | - | 1015177..1015857 (+) | 681 | WP_060555984.1 | hypothetical protein | - |
| LZT96_RS04965 (LZT96_04965) | - | 1015877..1016026 (+) | 150 | WP_203415624.1 | hypothetical protein | - |
| LZT96_RS04970 (LZT96_04970) | - | 1016019..1016201 (+) | 183 | WP_060555983.1 | DUF1024 family protein | - |
| LZT96_RS04975 (LZT96_04975) | - | 1016191..1016346 (+) | 156 | WP_203415623.1 | hypothetical protein | - |
| LZT96_RS04980 (LZT96_04980) | dut | 1016347..1016772 (+) | 426 | WP_060555982.1 | dUTP diphosphatase | - |
| LZT96_RS04985 (LZT96_04985) | - | 1016992..1017207 (+) | 216 | WP_275044178.1 | transcriptional regulator | - |
| LZT96_RS04990 (LZT96_04990) | - | 1017332..1017733 (+) | 402 | WP_060555981.1 | hypothetical protein | - |
| LZT96_RS04995 (LZT96_04995) | - | 1017980..1018423 (+) | 444 | WP_060555980.1 | terminase small subunit | - |
| LZT96_RS05000 (LZT96_05000) | - | 1018410..1019690 (+) | 1281 | WP_252909276.1 | PBSX family phage terminase large subunit | - |
| LZT96_RS05005 (LZT96_05005) | - | 1019702..1021234 (+) | 1533 | WP_060556005.1 | phage portal protein | - |
| LZT96_RS05010 (LZT96_05010) | - | 1021241..1022191 (+) | 951 | WP_252909275.1 | minor capsid protein | - |
| LZT96_RS05015 (LZT96_05015) | - | 1022211..1022753 (+) | 543 | WP_060556007.1 | hypothetical protein | - |
| LZT96_RS05020 (LZT96_05020) | - | 1022746..1022889 (+) | 144 | WP_202596173.1 | hypothetical protein | - |
| LZT96_RS05025 (LZT96_05025) | - | 1023143..1023748 (+) | 606 | WP_060556008.1 | DUF4355 domain-containing protein | - |
| LZT96_RS05030 (LZT96_05030) | - | 1023765..1024694 (+) | 930 | WP_049375360.1 | phage major capsid protein | - |
| LZT96_RS05035 (LZT96_05035) | - | 1024715..1024984 (+) | 270 | WP_060556009.1 | hypothetical protein | - |
| LZT96_RS05040 (LZT96_05040) | - | 1024986..1025315 (+) | 330 | WP_060556010.1 | phage head-tail connector protein | - |
| LZT96_RS05045 (LZT96_05045) | - | 1025312..1025614 (+) | 303 | WP_254582832.1 | hypothetical protein | - |
| LZT96_RS05050 (LZT96_05050) | - | 1025614..1025961 (+) | 348 | WP_080392172.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| LZT96_RS05055 (LZT96_05055) | - | 1025974..1026363 (+) | 390 | WP_060556012.1 | hypothetical protein | - |
| LZT96_RS05060 (LZT96_05060) | - | 1026406..1026963 (+) | 558 | WP_017465058.1 | phage major tail protein, TP901-1 family | - |
| LZT96_RS05065 (LZT96_05065) | - | 1027028..1027387 (+) | 360 | WP_002493371.1 | tail assembly chaperone | - |
| LZT96_RS05070 (LZT96_05070) | - | 1027432..1027776 (+) | 345 | WP_032605205.1 | hypothetical protein | - |
| LZT96_RS05075 (LZT96_05075) | - | 1027791..1031588 (+) | 3798 | WP_060556013.1 | hypothetical protein | - |
| LZT96_RS05080 (LZT96_05080) | - | 1031600..1032556 (+) | 957 | WP_060556014.1 | phage tail domain-containing protein | - |
| LZT96_RS05085 (LZT96_05085) | - | 1032568..1034028 (+) | 1461 | WP_060556015.1 | phage tail protein | - |
| LZT96_RS05090 (LZT96_05090) | - | 1034031..1035917 (+) | 1887 | WP_060556016.1 | M14 family metallopeptidase | - |
| LZT96_RS05095 (LZT96_05095) | - | 1035930..1037117 (+) | 1188 | WP_060556017.1 | BppU family phage baseplate upper protein | - |
| LZT96_RS05100 (LZT96_05100) | - | 1037131..1037553 (+) | 423 | WP_060556018.1 | hypothetical protein | - |
| LZT96_RS05105 (LZT96_05105) | - | 1037534..1037932 (+) | 399 | WP_060556019.1 | hypothetical protein | - |
| LZT96_RS05110 (LZT96_05110) | - | 1038344..1040110 (+) | 1767 | WP_275044180.1 | glucosaminidase domain-containing protein | - |
| LZT96_RS05115 (LZT96_05115) | - | 1040163..1041800 (+) | 1638 | WP_060556021.1 | BppU family phage baseplate upper protein | - |
| LZT96_RS05120 (LZT96_05120) | - | 1041812..1042147 (+) | 336 | WP_060556022.1 | hypothetical protein | - |
| LZT96_RS05125 (LZT96_05125) | - | 1042140..1042286 (+) | 147 | WP_002485853.1 | XkdX family protein | - |
| LZT96_RS05130 (LZT96_05130) | - | 1042349..1042759 (+) | 411 | WP_060556023.1 | phage holin | - |
| LZT96_RS05135 (LZT96_05135) | - | 1042734..1044197 (+) | 1464 | WP_126721110.1 | SH3 domain-containing protein | - |
| LZT96_RS05140 (LZT96_05140) | - | 1044618..1045097 (+) | 480 | WP_060556028.1 | hypothetical protein | - |
| LZT96_RS05145 (LZT96_05145) | - | 1045408..1045555 (-) | 148 | Protein_978 | tyrosine-type recombinase/integrase | - |
| LZT96_RS05150 (LZT96_05150) | - | 1045800..1046372 (-) | 573 | WP_002474676.1 | hypothetical protein | - |
| LZT96_RS05155 (LZT96_05155) | - | 1046386..1046919 (-) | 534 | WP_002498023.1 | hypothetical protein | - |
Sequence
Protein
Download Length: 143 a.a. Molecular weight: 15908.49 Da Isoelectric Point: 4.9117
>NTDB_id=646576 LZT96_RS04900 WP_060555994.1 1009466..1009897(+) (ssbA) [Staphylococcus epidermidis strain HAF242]
MLNRVVLVGRLTKDPEFRTTPSGVEVATFTLAVNRTFTNAQGEREADFINVVVFRKQAKNVNDYLSKGSLAGVDGRIQSR
NYENNEGRRVFVTEVVADSVQFLDSKGSNQQNNQPQQQRGQATAGNNPFANNNVDDDIEDLPF
MLNRVVLVGRLTKDPEFRTTPSGVEVATFTLAVNRTFTNAQGEREADFINVVVFRKQAKNVNDYLSKGSLAGVDGRIQSR
NYENNEGRRVFVTEVVADSVQFLDSKGSNQQNNQPQQQRGQATAGNNPFANNNVDDDIEDLPF
Nucleotide
Download Length: 432 bp
>NTDB_id=646576 LZT96_RS04900 WP_060555994.1 1009466..1009897(+) (ssbA) [Staphylococcus epidermidis strain HAF242]
ATGTTAAATAGAGTTGTATTAGTAGGTAGATTAACGAAAGATCCAGAGTTTAGAACTACGCCGAGTGGAGTTGAAGTAGC
AACATTCACTTTAGCAGTAAACAGAACATTTACTAACGCACAAGGTGAACGAGAAGCAGATTTCATCAATGTAGTTGTAT
TCAGAAAACAAGCGAAGAATGTAAATGATTATCTTTCAAAAGGTTCATTAGCAGGTGTAGATGGACGTATTCAATCACGT
AATTACGAAAATAACGAAGGTCGTCGAGTATTTGTAACAGAAGTTGTAGCTGATAGCGTTCAGTTCTTAGATAGCAAAGG
TAGTAACCAACAAAACAATCAACCTCAACAACAAAGAGGACAAGCGACAGCAGGGAACAACCCGTTTGCTAATAACAACG
TTGACGATGATATAGAAGATCTTCCTTTCTGA
ATGTTAAATAGAGTTGTATTAGTAGGTAGATTAACGAAAGATCCAGAGTTTAGAACTACGCCGAGTGGAGTTGAAGTAGC
AACATTCACTTTAGCAGTAAACAGAACATTTACTAACGCACAAGGTGAACGAGAAGCAGATTTCATCAATGTAGTTGTAT
TCAGAAAACAAGCGAAGAATGTAAATGATTATCTTTCAAAAGGTTCATTAGCAGGTGTAGATGGACGTATTCAATCACGT
AATTACGAAAATAACGAAGGTCGTCGAGTATTTGTAACAGAAGTTGTAGCTGATAGCGTTCAGTTCTTAGATAGCAAAGG
TAGTAACCAACAAAACAATCAACCTCAACAACAAAGAGGACAAGCGACAGCAGGGAACAACCCGTTTGCTAATAACAACG
TTGACGATGATATAGAAGATCTTCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
57.558 |
100 |
0.692 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.353 |
100 |
0.622 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
60.377 |
74.126 |
0.448 |
| ssbA | Streptococcus mutans UA159 |
39.31 |
100 |
0.399 |
| ssbB | Streptococcus sobrinus strain NIDR 6715-7 |
48.598 |
74.825 |
0.364 |