Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   L1A06_RS02710 Genome accession   NZ_CP090877
Coordinates   548186..548656 (-) Length   156 a.a.
NCBI ID   WP_033842379.1    Uniprot ID   -
Organism   Staphylococcus aureus strain SAUR_BFS11     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 510725..560396 548186..548656 within 0


Gene organization within MGE regions


Location: 510725..560396
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  L1A06_RS02445 (L1A06_02445) - 510725..511552 (-) 828 WP_000927632.1 sulfite exporter TauE/SafE family protein -
  L1A06_RS02450 (L1A06_02450) - 511565..512413 (-) 849 WP_000608129.1 DUF72 domain-containing protein -
  L1A06_RS02455 (L1A06_02455) - 512547..512645 (-) 99 WP_031835132.1 hypothetical protein -
  L1A06_RS02460 (L1A06_02460) - 512712..513779 (-) 1068 WP_000267249.1 NAD(P)H-dependent flavin oxidoreductase -
  L1A06_RS02465 (L1A06_02465) - 513793..514833 (-) 1041 WP_000582326.1 hemolysin family protein -
  L1A06_RS02470 (L1A06_02470) - 515198..515512 (+) 315 WP_000274029.1 hypothetical protein -
  L1A06_RS02475 (L1A06_02475) - 515518..515655 (-) 138 WP_001790198.1 chorismate mutase -
  L1A06_RS02480 (L1A06_02480) - 516292..517737 (-) 1446 WP_234865592.1 SH3 domain-containing protein -
  L1A06_RS02485 (L1A06_02485) - 517718..518155 (-) 438 WP_000354132.1 phage holin -
  L1A06_RS02490 (L1A06_02490) - 518211..518606 (-) 396 WP_234865595.1 hypothetical protein -
  L1A06_RS02495 (L1A06_02495) - 518612..519784 (-) 1173 WP_000276630.1 BppU family phage baseplate upper protein -
  L1A06_RS02500 (L1A06_02500) - 519797..521695 (-) 1899 WP_054194640.1 N-acetylglucosaminidase -
  L1A06_RS02505 (L1A06_02505) - 521832..522131 (-) 300 WP_000466777.1 DUF2951 domain-containing protein -
  L1A06_RS02510 (L1A06_02510) - 522171..522344 (-) 174 WP_000782200.1 XkdX family protein -
  L1A06_RS02515 (L1A06_02515) - 522348..522725 (-) 378 WP_000705913.1 DUF2977 domain-containing protein -
  L1A06_RS02520 (L1A06_02520) - 522725..524548 (-) 1824 WP_032099400.1 phage baseplate upper protein -
  L1A06_RS02525 (L1A06_02525) - 524548..526458 (-) 1911 WP_015977695.1 hypothetical protein -
  L1A06_RS02530 (L1A06_02530) - 526473..528374 (-) 1902 WP_033844986.1 SGNH/GDSL hydrolase family protein -
  L1A06_RS02535 (L1A06_02535) - 528383..529330 (-) 948 WP_000350675.1 phage tail family protein -
  L1A06_RS02540 (L1A06_02540) - 529343..532807 (-) 3465 WP_234865598.1 hypothetical protein -
  L1A06_RS02545 (L1A06_02545) - 532824..533168 (-) 345 WP_000105584.1 hypothetical protein -
  L1A06_RS02550 (L1A06_02550) - 533198..533563 (-) 366 WP_001100163.1 tail assembly chaperone -
  L1A06_RS02555 (L1A06_02555) - 533625..534206 (-) 582 WP_000002583.1 phage major tail protein, TP901-1 family -
  L1A06_RS02560 (L1A06_02560) - 534225..534608 (-) 384 WP_000188652.1 hypothetical protein -
  L1A06_RS02565 (L1A06_02565) - 534620..534967 (-) 348 WP_001017815.1 HK97-gp10 family putative phage morphogenesis protein -
  L1A06_RS02570 (L1A06_02570) - 534967..535269 (-) 303 WP_001268312.1 hypothetical protein -
  L1A06_RS02575 (L1A06_02575) - 535266..535598 (-) 333 WP_000208960.1 phage head-tail connector protein -
  L1A06_RS02580 (L1A06_02580) - 535607..535894 (-) 288 WP_001114085.1 hypothetical protein -
  L1A06_RS02585 (L1A06_02585) - 535916..536890 (-) 975 WP_000438513.1 phage major capsid protein -
  L1A06_RS02590 (L1A06_02590) - 536904..537524 (-) 621 WP_000392143.1 DUF4355 domain-containing protein -
  L1A06_RS14075 - 537518..537617 (-) 100 Protein_516 hypothetical protein -
  L1A06_RS02595 (L1A06_02595) - 537632..537802 (-) 171 WP_000072208.1 hypothetical protein -
  L1A06_RS02600 (L1A06_02600) - 537875..538870 (-) 996 WP_234865602.1 minor capsid protein -
  L1A06_RS02605 (L1A06_02605) - 538877..540412 (-) 1536 WP_234865605.1 phage portal protein -
  L1A06_RS02610 (L1A06_02610) - 540423..541700 (-) 1278 WP_031929822.1 PBSX family phage terminase large subunit -
  L1A06_RS02615 (L1A06_02615) - 541687..542127 (-) 441 WP_001003271.1 terminase small subunit -
  L1A06_RS02620 (L1A06_02620) - 542314..542733 (-) 420 WP_000058634.1 transcriptional regulator -
  L1A06_RS02625 (L1A06_02625) - 542748..542894 (-) 147 WP_000989997.1 hypothetical protein -
  L1A06_RS02630 (L1A06_02630) rinB 542895..543068 (-) 174 WP_070014293.1 transcriptional activator RinB -
  L1A06_RS02635 (L1A06_02635) - 543065..543271 (-) 207 WP_054189015.1 DUF1381 domain-containing protein -
  L1A06_RS02640 (L1A06_02640) - 543268..543513 (-) 246 WP_000120373.1 hypothetical protein -
  L1A06_RS02645 (L1A06_02645) - 543550..544077 (-) 528 WP_117216027.1 dUTPase -
  L1A06_RS02650 (L1A06_02650) - 544092..544253 (-) 162 WP_168777631.1 hypothetical protein -
  L1A06_RS02655 (L1A06_02655) - 544254..544535 (-) 282 WP_147701981.1 hypothetical protein -
  L1A06_RS02660 (L1A06_02660) - 544536..544709 (-) 174 WP_168777632.1 hypothetical protein -
  L1A06_RS02665 (L1A06_02665) - 544699..544950 (-) 252 WP_168768259.1 DUF1024 family protein -
  L1A06_RS02670 (L1A06_02670) - 544943..545251 (-) 309 WP_234865607.1 hypothetical protein -
  L1A06_RS02675 (L1A06_02675) - 545248..545595 (-) 348 WP_000979209.1 YopX family protein -
  L1A06_RS02680 (L1A06_02680) - 545592..545993 (-) 402 WP_000695762.1 hypothetical protein -
  L1A06_RS02685 (L1A06_02685) - 546007..546249 (-) 243 WP_000131370.1 SAV1978 family virulence-associated passenger protein -
  L1A06_RS02690 (L1A06_02690) - 546253..546621 (-) 369 WP_042903519.1 SA1788 family PVL leukocidin-associated protein -
  L1A06_RS02695 (L1A06_02695) - 546634..547038 (-) 405 WP_058342511.1 RusA family crossover junction endodeoxyribonuclease -
  L1A06_RS02700 (L1A06_02700) - 547047..547265 (-) 219 WP_000338530.1 hypothetical protein -
  L1A06_RS02705 (L1A06_02705) - 547272..548156 (-) 885 WP_234865610.1 DnaD domain protein -
  L1A06_RS02710 (L1A06_02710) ssbA 548186..548656 (-) 471 WP_033842379.1 single-stranded DNA-binding protein Machinery gene
  L1A06_RS02715 (L1A06_02715) - 548657..549274 (-) 618 WP_073394849.1 MBL fold metallo-hydrolase -
  L1A06_RS02720 (L1A06_02720) - 549355..550275 (-) 921 WP_000138475.1 recombinase RecT -
  L1A06_RS02725 (L1A06_02725) - 550277..552220 (-) 1944 WP_234865613.1 AAA family ATPase -
  L1A06_RS02730 (L1A06_02730) - 552229..552492 (-) 264 WP_001205732.1 hypothetical protein -
  L1A06_RS02735 (L1A06_02735) - 552501..552761 (-) 261 WP_000291075.1 DUF1108 family protein -
  L1A06_RS02740 (L1A06_02740) - 552854..553174 (-) 321 WP_033843163.1 hypothetical protein -
  L1A06_RS02745 (L1A06_02745) - 553175..553342 (-) 168 WP_033843162.1 DUF1270 domain-containing protein -
  L1A06_RS02750 (L1A06_02750) - 553335..553556 (-) 222 WP_234865616.1 hypothetical protein -
  L1A06_RS02755 (L1A06_02755) - 553570..554019 (-) 450 WP_234865619.1 hypothetical protein -
  L1A06_RS02760 (L1A06_02760) tscA 554059..554283 (-) 225 WP_000187184.1 type II toxin-antitoxin system antitoxin TscA -
  L1A06_RS02765 (L1A06_02765) - 554284..555075 (-) 792 WP_001148569.1 phage antirepressor -
  L1A06_RS02770 (L1A06_02770) - 555230..555547 (-) 318 WP_033843167.1 hypothetical protein -
  L1A06_RS02775 (L1A06_02775) - 555563..555817 (-) 255 WP_001106625.1 helix-turn-helix domain-containing protein -
  L1A06_RS02780 (L1A06_02780) - 556008..556646 (+) 639 WP_000874711.1 XRE family transcriptional regulator -
  L1A06_RS02785 (L1A06_02785) - 556678..557610 (+) 933 WP_000392186.1 hypothetical protein -
  L1A06_RS02790 (L1A06_02790) - 557590..557769 (-) 180 WP_000337826.1 hypothetical protein -
  L1A06_RS02795 (L1A06_02795) - 557882..558931 (+) 1050 WP_001145726.1 tyrosine-type recombinase/integrase -
  L1A06_RS02800 (L1A06_02800) sufB 558999..560396 (-) 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -

Sequence

Protein


Download         Length: 156 a.a.        Molecular weight: 17747.60 Da        Isoelectric Point: 4.7821

>NTDB_id=645423 L1A06_RS02710 WP_033842379.1 548186..548656(-) (ssbA) [Staphylococcus aureus strain SAUR_BFS11]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINIIVFKKQAENVNKYLSKGSLTGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQAQQSRGQSQYPYNKPVKDNPFANANDPIEIDDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=645423 L1A06_RS02710 WP_033842379.1 548186..548656(-) (ssbA) [Staphylococcus aureus strain SAUR_BFS11]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGAGAGCGCGAGGCAGACTTTATTAATATCATCGTAT
TTAAAAAACAAGCAGAGAACGTTAATAAATACCTATCTAAAGGATCGTTGACGGGCGTAGATGGTAGGTTACAAACGCGG
AATTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGACACTCAACAAGATTTATACCAACAACAAGCGCAACAATCACGTGGACAGTCTCAATATCCATATAACAAAC
CAGTAAAAGATAATCCGTTCGCAAATGCGAATGATCCTATTGAAATAGATGACGATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

54.802

100

0.622
  ssb Latilactobacillus sakei subsp. sakei 23K

52.353

100

0.571
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404
  ssb Neisseria meningitidis MC58

33.526

100

0.372
  ssb Neisseria gonorrhoeae MS11

33.526

100

0.372