Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | RSIB_RS06835 | Genome accession | NZ_AABW01000001 |
| Coordinates | 362496..362669 (-) | Length | 57 a.a. |
| NCBI ID | WP_004996409.1 | Uniprot ID | Q7PB38 |
| Organism | Rickettsia sibirica 246 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 357496..367669
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| RSIB_RS03920 (rsib_orf397) | - | 357708..358106 (-) | 399 | WP_010976966.1 | DUF2497 domain-containing protein | - |
| RSIB_RS03915 (rsib_orf398) | - | 358108..359469 (-) | 1362 | WP_004996393.1 | TolC family outer membrane protein | - |
| RSIB_RS05850 | - | 359778..359978 (+) | 201 | WP_032849764.1 | hypothetical protein | - |
| RSIB_RS03910 (rsib_orf400) | - | 360186..360668 (+) | 483 | WP_016728142.1 | hypothetical protein | - |
| RSIB_RS03905 (rsib_orf402) | - | 360865..361281 (+) | 417 | WP_004996401.1 | DUF2660 domain-containing protein | - |
| RSIB_RS08615 (rsib_orf403) | - | 361630..362001 (+) | 372 | WP_004996402.1 | DUF2310 family Zn-ribbon-containing protein | - |
| RSIB_RS03895 (rsib_orf404) | - | 362010..362267 (+) | 258 | WP_004996405.1 | DUF2310 family Zn-ribbon-containing protein | - |
| RSIB_RS03890 (rsib_orf405) | comA/nlmT | 362316..362471 (-) | 156 | WP_004996407.1 | hypothetical protein | Regulator |
| RSIB_RS06835 (rsib_orf406) | comA | 362496..362669 (-) | 174 | WP_004996409.1 | ATP-binding cassette domain-containing protein | Regulator |
| RSIB_RS08970 | - | 362835..362948 (-) | 114 | WP_014419734.1 | ATP-binding cassette domain-containing protein | - |
| RSIB_RS03885 (rsib_orf408) | - | 363410..364009 (-) | 600 | WP_004996413.1 | hypothetical protein | - |
| RSIB_RS03880 (rsib_orf409) | - | 364262..364486 (-) | 225 | WP_004996414.1 | hypothetical protein | - |
| RSIB_RS03875 (rsib_orf410) | thrS | 364574..366481 (-) | 1908 | WP_004996417.1 | threonine--tRNA ligase | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6232.25 Da Isoelectric Point: 10.4654
>NTDB_id=64383 RSIB_RS06835 WP_004996409.1 362496..362669(-) (comA) [Rickettsia sibirica 246]
MNLSKVYRKNINTIVGERGVKLSGGQRQRIAIVLAILKNAPILVLDEATSSLDSHTE
MNLSKVYRKNINTIVGERGVKLSGGQRQRIAIVLAILKNAPILVLDEATSSLDSHTE
Nucleotide
Download Length: 174 bp
>NTDB_id=64383 RSIB_RS06835 WP_004996409.1 362496..362669(-) (comA) [Rickettsia sibirica 246]
ATGAATTTATCGAAAGTTTACCGGAAAAATATAAACACCATTGTCGGTGAGAGAGGAGTAAAGCTAAGTGGTGGACAGAG
GCAACGTATAGCAATTGTCCTTGCTATTCTTAAAAACGCTCCGATTTTGGTTTTAGATGAAGCAACTTCAAGCCTTGATA
GCCATACAGAGTAA
ATGAATTTATCGAAAGTTTACCGGAAAAATATAAACACCATTGTCGGTGAGAGAGGAGTAAAGCTAAGTGGTGGACAGAG
GCAACGTATAGCAATTGTCCTTGCTATTCTTAAAAACGCTCCGATTTTGGTTTTAGATGAAGCAACTTCAAGCCTTGATA
GCCATACAGAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus mitis SK321 |
60.417 |
84.211 |
0.509 |
| comA | Streptococcus gordonii str. Challis substr. CH1 |
58.333 |
84.211 |
0.491 |
| comA | Streptococcus pneumoniae TIGR4 |
58.333 |
84.211 |
0.491 |
| comA | Streptococcus mitis NCTC 12261 |
58.333 |
84.211 |
0.491 |
| comA | Streptococcus pneumoniae Rx1 |
58.333 |
84.211 |
0.491 |
| comA | Streptococcus pneumoniae R6 |
58.333 |
84.211 |
0.491 |
| comA | Streptococcus pneumoniae D39 |
58.333 |
84.211 |
0.491 |
| rcrQ | Streptococcus mutans UA159 |
49.057 |
92.982 |
0.456 |
| comA/nlmT | Streptococcus mutans UA159 |
64.103 |
68.421 |
0.439 |
| rcrP | Streptococcus mutans UA159 |
37.5 |
98.246 |
0.368 |