Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   FH104_RS01605 Genome accession   NZ_CP090014
Coordinates   317511..317939 (-) Length   142 a.a.
NCBI ID   WP_242281835.1    Uniprot ID   -
Organism   Staphylococcus hominis strain acrlk     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 285152..325877 317511..317939 within 0


Gene organization within MGE regions


Location: 285152..325877
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FH104_RS01390 (FH104_01390) - 285152..285781 (-) 630 WP_242281803.1 hypothetical protein -
  FH104_RS01395 (FH104_01395) - 286033..287514 (-) 1482 WP_242281804.1 SH3 domain-containing protein -
  FH104_RS01400 (FH104_01400) - 287492..287977 (-) 486 WP_242281805.1 phage holin -
  FH104_RS01405 (FH104_01405) - 288028..288519 (-) 492 WP_242281806.1 holin family protein -
  FH104_RS01410 (FH104_01410) - 288576..288842 (-) 267 WP_070548292.1 hypothetical protein -
  FH104_RS01415 (FH104_01415) - 288855..291140 (-) 2286 WP_242281807.1 phage tail protein -
  FH104_RS01420 (FH104_01420) - 291149..292792 (-) 1644 WP_242281808.1 polysaccharide deacetylase family protein -
  FH104_RS01425 (FH104_01425) - 292806..293645 (-) 840 WP_242281809.1 phage tail domain-containing protein -
  FH104_RS01430 (FH104_01430) - 293649..300017 (-) 6369 WP_242281810.1 peptidoglycan DD-metalloendopeptidase family protein -
  FH104_RS01435 (FH104_01435) gpG 300221..300754 (-) 534 WP_242281811.1 phage tail assembly chaperone G -
  FH104_RS01440 (FH104_01440) - 300826..301416 (-) 591 WP_053020662.1 major tail protein -
  FH104_RS01445 (FH104_01445) - 301423..301821 (-) 399 WP_242281812.1 hypothetical protein -
  FH104_RS01450 (FH104_01450) - 301811..302236 (-) 426 WP_242281813.1 HK97-gp10 family putative phage morphogenesis protein -
  FH104_RS01455 (FH104_01455) - 302236..302559 (-) 324 WP_242281814.1 phage head closure protein -
  FH104_RS01460 (FH104_01460) - 302529..302852 (-) 324 WP_070436663.1 head-tail connector protein -
  FH104_RS01465 (FH104_01465) - 302861..303037 (-) 177 WP_162837136.1 hypothetical protein -
  FH104_RS01470 (FH104_01470) - 303050..304264 (-) 1215 WP_242281815.1 phage major capsid protein -
  FH104_RS01475 (FH104_01475) - 304358..304942 (-) 585 WP_242281870.1 HK97 family phage prohead protease -
  FH104_RS01480 (FH104_01480) - 304917..306155 (-) 1239 WP_242281816.1 phage portal protein -
  FH104_RS01485 (FH104_01485) - 306171..306368 (-) 198 WP_242281817.1 hypothetical protein -
  FH104_RS01490 (FH104_01490) - 306380..308089 (-) 1710 WP_242281818.1 terminase large subunit -
  FH104_RS01495 (FH104_01495) - 308079..308546 (-) 468 WP_242281819.1 phage terminase small subunit P27 family -
  FH104_RS01500 (FH104_01500) - 308690..308950 (-) 261 WP_176743909.1 HNH endonuclease -
  FH104_RS01505 (FH104_01505) - 309247..309714 (-) 468 WP_242281820.1 hypothetical protein -
  FH104_RS01510 (FH104_01510) - 309728..309910 (-) 183 WP_242281821.1 DUF1514 family protein -
  FH104_RS01515 (FH104_01515) - 309923..310189 (-) 267 WP_242281822.1 hypothetical protein -
  FH104_RS01520 (FH104_01520) - 310194..310688 (-) 495 WP_242281823.1 hypothetical protein -
  FH104_RS01525 (FH104_01525) - 310688..310870 (-) 183 WP_242281824.1 hypothetical protein -
  FH104_RS01530 (FH104_01530) - 310931..311185 (+) 255 WP_242281825.1 hypothetical protein -
  FH104_RS01535 (FH104_01535) - 311252..311569 (-) 318 WP_242281826.1 MazG-like family protein -
  FH104_RS01540 (FH104_01540) - 311562..311837 (-) 276 WP_242281827.1 hypothetical protein -
  FH104_RS01545 (FH104_01545) - 311818..312021 (-) 204 WP_242281828.1 hypothetical protein -
  FH104_RS01550 (FH104_01550) - 312012..312695 (-) 684 WP_242281829.1 hypothetical protein -
  FH104_RS01555 (FH104_01555) - 312692..313453 (-) 762 WP_242281830.1 ParB/RepB/Spo0J family partition protein -
  FH104_RS01560 (FH104_01560) - 313446..313913 (-) 468 WP_242281831.1 DUF3310 domain-containing protein -
  FH104_RS01565 (FH104_01565) - 313918..314169 (-) 252 WP_242281832.1 hypothetical protein -
  FH104_RS01570 (FH104_01570) - 314357..314551 (-) 195 WP_145452860.1 hypothetical protein -
  FH104_RS01575 (FH104_01575) - 314554..314781 (-) 228 WP_107636309.1 hypothetical protein -
  FH104_RS01580 (FH104_01580) - 314796..315029 (-) 234 WP_053022116.1 hypothetical protein -
  FH104_RS01585 (FH104_01585) - 315029..315190 (-) 162 WP_172457911.1 hypothetical protein -
  FH104_RS01590 (FH104_01590) - 315187..315975 (-) 789 WP_242281833.1 ATP-binding protein -
  FH104_RS01595 (FH104_01595) - 315987..316808 (-) 822 WP_242281834.1 DnaD domain protein -
  FH104_RS01600 (FH104_01600) - 316822..317499 (-) 678 WP_107636291.1 putative HNHc nuclease -
  FH104_RS01605 (FH104_01605) ssbA 317511..317939 (-) 429 WP_242281835.1 single-stranded DNA-binding protein Machinery gene
  FH104_RS01610 (FH104_01610) - 317957..318202 (-) 246 WP_242281836.1 hypothetical protein -
  FH104_RS01615 (FH104_01615) - 318279..318452 (-) 174 WP_242281837.1 hypothetical protein -
  FH104_RS01620 (FH104_01620) - 318483..318785 (-) 303 WP_242281838.1 DUF771 domain-containing protein -
  FH104_RS01625 (FH104_01625) - 318849..319130 (+) 282 WP_242281839.1 hypothetical protein -
  FH104_RS01630 (FH104_01630) - 319127..319390 (-) 264 WP_242281840.1 hypothetical protein -
  FH104_RS01635 (FH104_01635) - 319442..319603 (-) 162 WP_242281841.1 hypothetical protein -
  FH104_RS01640 (FH104_01640) - 319664..319903 (+) 240 WP_242281842.1 hypothetical protein -
  FH104_RS01645 (FH104_01645) - 320079..320870 (-) 792 WP_242281843.1 phage antirepressor -
  FH104_RS01650 (FH104_01650) - 320901..321125 (-) 225 WP_242281844.1 DUF739 family protein -
  FH104_RS01655 (FH104_01655) - 321287..321667 (+) 381 WP_242281845.1 helix-turn-helix domain-containing protein -
  FH104_RS01660 (FH104_01660) - 321798..322415 (-) 618 WP_242281846.1 hypothetical protein -
  FH104_RS01665 (FH104_01665) - 322483..322947 (+) 465 WP_242281847.1 ImmA/IrrE family metallo-endopeptidase -
  FH104_RS01670 (FH104_01670) - 322958..323491 (+) 534 WP_242281848.1 hypothetical protein -
  FH104_RS01675 (FH104_01675) - 323517..324488 (+) 972 WP_242281849.1 hypothetical protein -
  FH104_RS01680 (FH104_01680) - 324471..324647 (-) 177 WP_242281850.1 hypothetical protein -
  FH104_RS01685 (FH104_01685) - 324816..325877 (+) 1062 WP_242281851.1 site-specific integrase -

Sequence


Protein


Download         Length: 142 a.a.        Molecular weight: 15790.54 Da        Isoelectric Point: 5.9067

>NTDB_id=640200 FH104_RS01605 WP_242281835.1 317511..317939(-) (ssbA) [Staphylococcus hominis strain acrlk]
MINRATLVGRLTKDPEYRVTPSGVAVATFTLAINRTFTNANGEREADFINCVVFRRQAENVNKFLFKGNLAGVDGRLQSR
SYENQEGRRVFVTEVVADNVHFLEPKNSKSGQQTKSDDQPVGNNPFQNANGPIDIGDEDLPF

Nucleotide


Download         Length: 429 bp        

>NTDB_id=640200 FH104_RS01605 WP_242281835.1 317511..317939(-) (ssbA) [Staphylococcus hominis strain acrlk]
TTGATTAATAGAGCAACGTTAGTAGGAAGGCTAACAAAAGATCCTGAATATCGTGTAACACCTTCAGGGGTAGCAGTAGC
GACATTTACTTTAGCTATTAACAGAACGTTCACTAATGCAAATGGAGAAAGAGAAGCGGATTTTATTAACTGTGTAGTTT
TTAGAAGACAGGCAGAGAACGTTAACAAGTTTTTGTTTAAAGGTAACTTAGCTGGCGTTGATGGGCGCTTGCAATCAAGA
AGTTATGAAAATCAAGAAGGGCGTAGAGTATTTGTAACTGAAGTGGTAGCAGATAATGTTCACTTCTTAGAACCAAAAAA
TAGTAAGAGTGGCCAACAAACTAAAAGTGATGATCAACCAGTAGGTAATAATCCATTCCAAAATGCAAATGGGCCGATTG
ATATTGGTGATGAAGATTTACCGTTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

57.558

100

0.697

  ssb Latilactobacillus sakei subsp. sakei 23K

50.588

100

0.606

  ssbB Bacillus subtilis subsp. subtilis str. 168

58.491

74.648

0.437

  ssbB/cilA Streptococcus pneumoniae TIGR4

36.62

100

0.366

  ssbB Streptococcus sobrinus strain NIDR 6715-7

35.374

100

0.366