Detailed information
Overview
| Name | comC/comC2 | Type | Regulator |
| Locus tag | LXA46_RS10840 | Genome accession | NZ_CP089948 |
| Coordinates | 2150571..2150696 (-) | Length | 41 a.a. |
| NCBI ID | WP_000799686.1 | Uniprot ID | P60242 |
| Organism | Streptococcus pneumoniae TIGR4 | ||
| Function | binding to ComD; induce autophosphorylation of ComD (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2145571..2155696
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LXA46_RS10810 (LXA46_10795) | - | 2145910..2147512 (-) | 1603 | Protein_2124 | YhgE/Pip domain-containing protein | - |
| LXA46_RS10815 (LXA46_10800) | - | 2147691..2148233 (+) | 543 | WP_001158266.1 | TetR/AcrR family transcriptional regulator | - |
| LXA46_RS10830 (LXA46_10815) | comE | 2148476..2149228 (-) | 753 | WP_000866065.1 | competence system response regulator transcription factor ComE | Regulator |
| LXA46_RS10835 (LXA46_10820) | comD/comD2 | 2149225..2150550 (-) | 1326 | WP_000364845.1 | competence system sensor histidine kinase ComD | Regulator |
| LXA46_RS10840 (LXA46_10825) | comC/comC2 | 2150571..2150696 (-) | 126 | WP_000799686.1 | competence-stimulating peptide ComC | Regulator |
| LXA46_RS10850 (LXA46_10835) | rlmH | 2150978..2151457 (-) | 480 | WP_000695929.1 | 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH | - |
| LXA46_RS10855 (LXA46_10840) | htrA | 2151640..2152821 (+) | 1182 | WP_000681597.1 | trypsin-like peptidase domain-containing protein | Regulator |
| LXA46_RS10860 (LXA46_10845) | spo0J | 2152879..2153637 (+) | 759 | WP_000410378.1 | ParB/RepB/Spo0J family partition protein | Regulator |
Sequence
Protein
Download Length: 41 a.a. Molecular weight: 4907.00 Da Isoelectric Point: 11.0006
>NTDB_id=639379 LXA46_RS10840 WP_000799686.1 2150571..2150696(-) (comC/comC2) [Streptococcus pneumoniae TIGR4]
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
MKNTVKLEQFVALKEKDLQKIKGGEMRISRIILDFLFLRKK
Nucleotide
Download Length: 126 bp
>NTDB_id=639379 LXA46_RS10840 WP_000799686.1 2150571..2150696(-) (comC/comC2) [Streptococcus pneumoniae TIGR4]
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
ATGAAAAACACAGTTAAATTGGAACAGTTTGTAGCTTTGAAGGAAAAAGACTTACAAAAGATTAAAGGTGGGGAGATGAG
GATTTCAAGAATCATCCTTGATTTTCTTTTCCTACGAAAAAAGTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comC/comC2 | Streptococcus pneumoniae A66 |
100 |
100 |
1 |
| comC/comC2 | Streptococcus pneumoniae TIGR4 |
100 |
100 |
1 |
| comC/comC1 | Streptococcus pneumoniae R6 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae G54 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae D39 |
80.488 |
100 |
0.805 |
| comC/comC1 | Streptococcus pneumoniae Rx1 |
80.488 |
100 |
0.805 |
| comC | Streptococcus mitis SK321 |
75.61 |
100 |
0.756 |
| comC | Streptococcus mitis NCTC 12261 |
57.5 |
97.561 |
0.561 |