Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LU631_RS03205 | Genome accession | NZ_CP089940 |
| Coordinates | 628381..628917 (+) | Length | 178 a.a. |
| NCBI ID | WP_020322984.1 | Uniprot ID | - |
| Organism | Erwinia tracheiphila strain BuffGH | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 571818..643911 | 628381..628917 | within | 0 |
Gene organization within MGE regions
Location: 571818..643911
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU631_RS02910 (LU631_02910) | proP | 571818..573323 (-) | 1506 | WP_016191141.1 | glycine betaine/L-proline transporter ProP | - |
| LU631_RS02915 (LU631_02915) | - | 573716..574032 (+) | 317 | Protein_568 | DHCW motif cupin fold protein | - |
| LU631_RS02920 (LU631_02920) | - | 574306..575520 (-) | 1215 | WP_046371879.1 | IS91 family transposase | - |
| LU631_RS02925 (LU631_02925) | - | 575529..575669 (-) | 141 | WP_161796965.1 | hypothetical protein | - |
| LU631_RS02930 (LU631_02930) | - | 576090..576233 (+) | 144 | WP_016191139.1 | hypothetical protein | - |
| LU631_RS02935 (LU631_02935) | - | 576236..577425 (+) | 1190 | Protein_572 | baseplate J/gp47 family protein | - |
| LU631_RS02940 (LU631_02940) | - | 577422..578075 (+) | 654 | WP_016191138.1 | DUF2612 domain-containing protein | - |
| LU631_RS02945 (LU631_02945) | - | 578151..578348 (+) | 198 | WP_016191137.1 | hypothetical protein | - |
| LU631_RS02950 (LU631_02950) | - | 578486..579526 (+) | 1041 | WP_046371818.1 | IS481 family transposase | - |
| LU631_RS02955 (LU631_02955) | - | 579696..580067 (+) | 372 | WP_052734724.1 | DUF2335 domain-containing protein | - |
| LU631_RS02960 (LU631_02960) | - | 580187..581509 (+) | 1323 | WP_233481980.1 | IS4 family transposase | - |
| LU631_RS02965 (LU631_02965) | - | 581917..582546 (-) | 630 | WP_016191136.1 | LexA family protein | - |
| LU631_RS02970 (LU631_02970) | - | 582684..582890 (+) | 207 | WP_016191135.1 | helix-turn-helix transcriptional regulator | - |
| LU631_RS02975 (LU631_02975) | - | 582894..585050 (+) | 2157 | WP_016191134.1 | AAA family ATPase | - |
| LU631_RS02980 (LU631_02980) | - | 585097..585264 (-) | 168 | WP_157275232.1 | hypothetical protein | - |
| LU631_RS02985 (LU631_02985) | - | 585378..586112 (+) | 735 | WP_016191133.1 | competence protein CoiA | - |
| LU631_RS02990 (LU631_02990) | - | 586187..586612 (+) | 426 | WP_016191132.1 | antiterminator Q family protein | - |
| LU631_RS02995 (LU631_02995) | - | 586984..587298 (+) | 315 | WP_411813672.1 | phage holin family protein | - |
| LU631_RS03000 (LU631_03000) | - | 587288..587827 (+) | 540 | WP_016193236.1 | NUMOD4 motif-containing HNH endonuclease | - |
| LU631_RS03005 (LU631_03005) | - | 587824..588249 (+) | 426 | WP_016193237.1 | lysozyme | - |
| LU631_RS03010 (LU631_03010) | - | 588442..588639 (+) | 198 | WP_071598980.1 | Rz1 family lipoprotein | - |
| LU631_RS03015 (LU631_03015) | - | 588735..589505 (+) | 771 | WP_233481981.1 | hypothetical protein | - |
| LU631_RS03020 (LU631_03020) | - | 589515..589943 (+) | 429 | WP_046372151.1 | hypothetical protein | - |
| LU631_RS03025 (LU631_03025) | - | 589962..590216 (+) | 255 | WP_046372152.1 | hypothetical protein | - |
| LU631_RS03030 (LU631_03030) | - | 590222..590704 (+) | 483 | WP_046372153.1 | DNA-packaging protein | - |
| LU631_RS03035 (LU631_03035) | - | 590856..592181 (+) | 1326 | WP_407647022.1 | terminase large subunit domain-containing protein | - |
| LU631_RS03040 (LU631_03040) | - | 592181..594296 (+) | 2116 | Protein_593 | portal protein | - |
| LU631_RS03045 (LU631_03045) | - | 594310..595216 (+) | 907 | Protein_594 | scaffolding protein | - |
| LU631_RS03050 (LU631_03050) | - | 595228..596523 (+) | 1296 | WP_016193240.1 | P22 phage major capsid protein family protein | - |
| LU631_RS03055 (LU631_03055) | - | 596565..596915 (+) | 351 | WP_072052850.1 | hypothetical protein | - |
| LU631_RS03060 (LU631_03060) | - | 596899..597384 (+) | 486 | WP_046372155.1 | packaged DNA stabilization gp4 family protein | - |
| LU631_RS03065 (LU631_03065) | - | 597362..598885 (+) | 1524 | WP_411813673.1 | packaged DNA stabilization protein | - |
| LU631_RS25970 | - | 598818..599132 (+) | 315 | WP_267958443.1 | packaged DNA stabilization protein | - |
| LU631_RS03070 (LU631_03070) | - | 599125..599619 (+) | 495 | WP_046372156.1 | hypothetical protein | - |
| LU631_RS03075 (LU631_03075) | - | 599622..599984 (+) | 363 | WP_020323013.1 | hypothetical protein | - |
| LU631_RS03080 (LU631_03080) | - | 599986..600570 (+) | 585 | WP_020323012.1 | hypothetical protein | - |
| LU631_RS03085 (LU631_03085) | - | 600570..601859 (+) | 1290 | WP_020323011.1 | phage DNA ejection protein | - |
| LU631_RS03090 (LU631_03090) | - | 601859..603985 (+) | 2127 | WP_020323010.1 | hypothetical protein | - |
| LU631_RS03095 (LU631_03095) | - | 604700..605497 (-) | 798 | WP_020323008.1 | Bro-N domain-containing protein | - |
| LU631_RS03100 (LU631_03100) | - | 605553..605699 (+) | 147 | WP_198292519.1 | hypothetical protein | - |
| LU631_RS03105 (LU631_03105) | - | 605845..607116 (+) | 1272 | WP_052734726.1 | phage tailspike protein | - |
| LU631_RS03110 (LU631_03110) | - | 607146..607472 (-) | 327 | WP_016191793.1 | DUF1493 family protein | - |
| LU631_RS03115 (LU631_03115) | - | 607466..607912 (-) | 447 | WP_020323001.1 | STM2901 family protein | - |
| LU631_RS03120 (LU631_03120) | - | 607978..609075 (-) | 1098 | WP_020323000.1 | tyrosine-type recombinase/integrase | - |
| LU631_RS03125 (LU631_03125) | dusA | 609165..610214 (+) | 1050 | WP_020322999.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| LU631_RS03130 (LU631_03130) | - | 610874..611571 (+) | 698 | WP_233481982.1 | IS1 family transposase | - |
| LU631_RS03135 (LU631_03135) | pspG | 612290..612502 (+) | 213 | WP_040465462.1 | envelope stress response protein PspG | - |
| LU631_RS03140 (LU631_03140) | - | 612746..613726 (-) | 981 | WP_020322995.1 | quinone oxidoreductase | - |
| LU631_RS03145 (LU631_03145) | dnaB | 613828..615243 (+) | 1416 | WP_020322994.1 | replicative DNA helicase | - |
| LU631_RS03150 (LU631_03150) | - | 615336..616033 (+) | 698 | WP_233481983.1 | IS1 family transposase | - |
| LU631_RS03155 (LU631_03155) | - | 616311..616811 (+) | 501 | WP_020322993.1 | exochitinase | - |
| LU631_RS03160 (LU631_03160) | - | 616963..618882 (+) | 1920 | WP_020322992.1 | S8 family serine peptidase | - |
| LU631_RS03165 (LU631_03165) | - | 619354..619759 (+) | 406 | Protein_619 | Lrp/AsnC family transcriptional regulator | - |
| LU631_RS03170 (LU631_03170) | tnpA | 619929..620366 (+) | 438 | WP_046372172.1 | IS200/IS605 family transposase | - |
| LU631_RS03175 (LU631_03175) | - | 620651..621257 (+) | 607 | Protein_621 | YitT family protein | - |
| LU631_RS03180 (LU631_03180) | - | 621316..622509 (+) | 1194 | WP_020322990.1 | amino acid aminotransferase | - |
| LU631_RS03185 (LU631_03185) | - | 622810..623222 (+) | 413 | Protein_623 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
| LU631_RS03190 (LU631_03190) | - | 623260..623560 (+) | 301 | Protein_624 | MmcQ/YjbR family DNA-binding protein | - |
| LU631_RS03195 (LU631_03195) | - | 623838..624890 (-) | 1053 | WP_020322986.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| LU631_RS03200 (LU631_03200) | uvrA | 625253..628078 (-) | 2826 | WP_020322985.1 | excinuclease ABC subunit UvrA | - |
| LU631_RS03205 (LU631_03205) | ssb | 628381..628917 (+) | 537 | WP_020322984.1 | single-stranded DNA-binding protein SSB1 | Machinery gene |
| LU631_RS25975 | - | 629481..630065 (+) | 585 | WP_020322983.1 | reverse transcriptase domain-containing protein | - |
| LU631_RS25980 | - | 629998..630591 (+) | 594 | WP_198292518.1 | reverse transcriptase domain-containing protein | - |
| LU631_RS03215 (LU631_03215) | - | 630702..631911 (+) | 1210 | Protein_630 | IS256 family transposase | - |
| LU631_RS03220 (LU631_03220) | - | 631996..633320 (+) | 1325 | Protein_631 | IS4 family transposase | - |
| LU631_RS26515 | - | 633374..633460 (+) | 87 | WP_407647024.1 | hypothetical protein | - |
| LU631_RS03225 (LU631_03225) | - | 633696..633920 (-) | 225 | Protein_633 | transposase | - |
| LU631_RS03230 (LU631_03230) | - | 633979..635019 (-) | 1041 | WP_046371791.1 | IS481 family transposase | - |
| LU631_RS03235 (LU631_03235) | - | 635123..636114 (-) | 992 | Protein_635 | IS256 family transposase | - |
| LU631_RS03240 (LU631_03240) | - | 636543..637190 (+) | 648 | Protein_636 | IS6 family transposase | - |
| LU631_RS03245 (LU631_03245) | - | 637346..637543 (+) | 198 | WP_020322980.1 | amidohydrolase | - |
| LU631_RS03250 (LU631_03250) | - | 637639..638127 (+) | 489 | WP_051124368.1 | hypothetical protein | - |
| LU631_RS03255 (LU631_03255) | - | 638120..638272 (+) | 153 | WP_161796994.1 | alpha/beta fold hydrolase | - |
| LU631_RS03260 (LU631_03260) | - | 638405..638851 (+) | 447 | WP_020322979.1 | DUF3828 domain-containing protein | - |
| LU631_RS25985 | - | 638848..639153 (-) | 306 | WP_407647025.1 | DUF535 family protein | - |
| LU631_RS03270 (LU631_03270) | - | 639051..639460 (-) | 410 | Protein_642 | DUF535 family protein | - |
| LU631_RS03275 (LU631_03275) | - | 640490..641704 (-) | 1215 | WP_046371879.1 | IS91 family transposase | - |
| LU631_RS03280 (LU631_03280) | - | 641713..641853 (-) | 141 | WP_161796965.1 | hypothetical protein | - |
| LU631_RS03285 (LU631_03285) | - | 643516..643911 (-) | 396 | WP_020322977.1 | IS3 family transposase | - |
Sequence
Protein
Download Length: 178 a.a. Molecular weight: 19080.03 Da Isoelectric Point: 5.2456
>NTDB_id=639266 LU631_RS03205 WP_020322984.1 628381..628917(+) (ssb) [Erwinia tracheiphila strain BuffGH]
MASRGINKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQTGETKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGALQTRKWTDQAGVEKYTTEVVVNVGGTMQMLGGRQGGGAQAGGNNQGNNNGWGQPQQPQGGNQFSGGGQASRPQSQQN
SAPISNEPPMDFDDDIPF
MASRGINKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQTGETKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGALQTRKWTDQAGVEKYTTEVVVNVGGTMQMLGGRQGGGAQAGGNNQGNNNGWGQPQQPQGGNQFSGGGQASRPQSQQN
SAPISNEPPMDFDDDIPF
Nucleotide
Download Length: 537 bp
>NTDB_id=639266 LU631_RS03205 WP_020322984.1 628381..628917(+) (ssb) [Erwinia tracheiphila strain BuffGH]
ATGGCCAGCAGAGGCATAAATAAAGTGATCCTGGTAGGCAACCTGGGTCAGGATCCTGAAGTCCGTTACATGCCGAATGG
CGGTGCTGTTGCCAATATCACTCTGGCTACCTCTGAAAGCTGGCGTGACAAACAGACTGGTGAAACTAAAGAGAAAACAG
AATGGCATCGCGTGGTGCTGTTTGGAAAGCTTGCTGAAGTGGCGGGCGAATATCTGCGCAAAGGTTCTCAGGTTTATATT
GAGGGTGCGCTTCAGACGCGTAAATGGACCGATCAGGCAGGCGTTGAGAAATACACCACAGAAGTGGTTGTTAACGTTGG
TGGCACCATGCAGATGCTGGGTGGCCGCCAGGGCGGCGGTGCGCAGGCTGGTGGTAATAACCAGGGTAATAATAACGGCT
GGGGTCAGCCTCAGCAGCCGCAGGGCGGCAACCAGTTCAGCGGCGGCGGTCAGGCGTCACGGCCACAGTCACAGCAAAAC
AGCGCACCCATCAGCAATGAACCGCCGATGGATTTTGACGACGATATCCCGTTTTGA
ATGGCCAGCAGAGGCATAAATAAAGTGATCCTGGTAGGCAACCTGGGTCAGGATCCTGAAGTCCGTTACATGCCGAATGG
CGGTGCTGTTGCCAATATCACTCTGGCTACCTCTGAAAGCTGGCGTGACAAACAGACTGGTGAAACTAAAGAGAAAACAG
AATGGCATCGCGTGGTGCTGTTTGGAAAGCTTGCTGAAGTGGCGGGCGAATATCTGCGCAAAGGTTCTCAGGTTTATATT
GAGGGTGCGCTTCAGACGCGTAAATGGACCGATCAGGCAGGCGTTGAGAAATACACCACAGAAGTGGTTGTTAACGTTGG
TGGCACCATGCAGATGCTGGGTGGCCGCCAGGGCGGCGGTGCGCAGGCTGGTGGTAATAACCAGGGTAATAATAACGGCT
GGGGTCAGCCTCAGCAGCCGCAGGGCGGCAACCAGTTCAGCGGCGGCGGTCAGGCGTCACGGCCACAGTCACAGCAAAAC
AGCGCACCCATCAGCAATGAACCGCCGATGGATTTTGACGACGATATCCCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
71.978 |
100 |
0.736 |
| ssb | Glaesserella parasuis strain SC1401 |
55.738 |
100 |
0.573 |
| ssb | Neisseria meningitidis MC58 |
43.716 |
100 |
0.449 |
| ssb | Neisseria gonorrhoeae MS11 |
43.094 |
100 |
0.438 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
38.764 |
100 |
0.388 |