Detailed information
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | LU633_RS01880 | Genome accession | NZ_CP089932 |
| Coordinates | 379507..380043 (+) | Length | 178 a.a. |
| NCBI ID | WP_020322984.1 | Uniprot ID | - |
| Organism | Erwinia tracheiphila strain BHKY | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 317395..388311 | 379507..380043 | within | 0 |
Gene organization within MGE regions
Location: 317395..388311
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LU633_RS01550 (LU633_01550) | polA | 317395..320178 (+) | 2784 | WP_016192282.1 | DNA polymerase I | - |
| LU633_RS01555 (LU633_01555) | - | 320247..321287 (-) | 1041 | Protein_299 | IS481 family transposase | - |
| LU633_RS01560 (LU633_01560) | yihA | 321366..322025 (-) | 660 | WP_016192279.1 | ribosome biogenesis GTP-binding protein YihA/YsxC | - |
| LU633_RS01565 (LU633_01565) | - | 322476..322649 (+) | 174 | WP_157275260.1 | hypothetical protein | - |
| LU633_RS01570 (LU633_01570) | - | 322693..323082 (+) | 390 | Protein_302 | phage baseplate protein | - |
| LU633_RS01575 (LU633_01575) | - | 323072..323371 (+) | 300 | WP_016192277.1 | phage baseplate plug protein | - |
| LU633_RS01580 (LU633_01580) | - | 323406..324386 (+) | 981 | WP_016192276.1 | phage protein | - |
| LU633_RS01585 (LU633_01585) | - | 324386..325141 (+) | 756 | WP_016192275.1 | Gp138 family membrane-puncturing spike protein | - |
| LU633_RS01590 (LU633_01590) | - | 325138..325317 (+) | 180 | Protein_306 | hypothetical protein | - |
| LU633_RS01595 (LU633_01595) | - | 325464..326678 (-) | 1215 | WP_046371879.1 | IS91 family transposase | - |
| LU633_RS01600 (LU633_01600) | - | 326687..326827 (-) | 141 | WP_161796965.1 | hypothetical protein | - |
| LU633_RS01605 (LU633_01605) | - | 327248..327391 (+) | 144 | WP_016191139.1 | hypothetical protein | - |
| LU633_RS01610 (LU633_01610) | - | 327394..328583 (+) | 1190 | Protein_310 | baseplate J/gp47 family protein | - |
| LU633_RS01615 (LU633_01615) | - | 328580..329233 (+) | 654 | WP_016191138.1 | DUF2612 domain-containing protein | - |
| LU633_RS01620 (LU633_01620) | - | 329309..329506 (+) | 198 | WP_016191137.1 | hypothetical protein | - |
| LU633_RS01625 (LU633_01625) | - | 329644..330684 (+) | 1041 | WP_046371818.1 | IS481 family transposase | - |
| LU633_RS01630 (LU633_01630) | - | 330854..331225 (+) | 372 | WP_052734724.1 | DUF2335 domain-containing protein | - |
| LU633_RS01635 (LU633_01635) | - | 331345..332666 (+) | 1322 | Protein_315 | IS4 family transposase | - |
| LU633_RS01640 (LU633_01640) | - | 333074..333703 (-) | 630 | WP_016191136.1 | LexA family transcriptional regulator | - |
| LU633_RS01645 (LU633_01645) | - | 333841..334047 (+) | 207 | WP_016191135.1 | helix-turn-helix transcriptional regulator | - |
| LU633_RS01650 (LU633_01650) | - | 334051..336207 (+) | 2157 | WP_016191134.1 | AAA family ATPase | - |
| LU633_RS01655 (LU633_01655) | - | 336254..336421 (-) | 168 | WP_157275232.1 | hypothetical protein | - |
| LU633_RS01660 (LU633_01660) | - | 336535..337269 (+) | 735 | WP_016191133.1 | competence protein CoiA | - |
| LU633_RS01665 (LU633_01665) | - | 337344..337769 (+) | 426 | WP_016191132.1 | antiterminator Q family protein | - |
| LU633_RS01670 (LU633_01670) | - | 338204..338455 (+) | 252 | WP_407647021.1 | phage holin family protein | - |
| LU633_RS01675 (LU633_01675) | - | 338445..338984 (+) | 540 | WP_016193236.1 | NUMOD4 motif-containing HNH endonuclease | - |
| LU633_RS01680 (LU633_01680) | - | 338981..339406 (+) | 426 | WP_016193237.1 | lysozyme | - |
| LU633_RS01685 (LU633_01685) | - | 339599..339796 (+) | 198 | WP_071598980.1 | Rz1 family lipoprotein | - |
| LU633_RS01690 (LU633_01690) | - | 339892..340662 (+) | 771 | WP_233481981.1 | hypothetical protein | - |
| LU633_RS01695 (LU633_01695) | - | 340672..341100 (+) | 429 | WP_046372151.1 | hypothetical protein | - |
| LU633_RS01700 (LU633_01700) | - | 341118..341372 (+) | 255 | WP_046372152.1 | hypothetical protein | - |
| LU633_RS01705 (LU633_01705) | - | 341378..341860 (+) | 483 | WP_046372153.1 | DNA-packaging protein | - |
| LU633_RS01710 (LU633_01710) | - | 342012..343337 (+) | 1326 | WP_407647022.1 | terminase large subunit domain-containing protein | - |
| LU633_RS01715 (LU633_01715) | - | 343337..345451 (+) | 2115 | WP_072052774.1 | portal protein | - |
| LU633_RS01720 (LU633_01720) | - | 345465..346373 (+) | 909 | WP_016193239.1 | scaffolding protein | - |
| LU633_RS01725 (LU633_01725) | - | 346385..347680 (+) | 1296 | WP_016193240.1 | P22 phage major capsid protein family protein | - |
| LU633_RS01730 (LU633_01730) | - | 347722..348042 (+) | 321 | WP_233485080.1 | hypothetical protein | - |
| LU633_RS01735 (LU633_01735) | - | 348026..348511 (+) | 486 | WP_046372155.1 | packaged DNA stabilization gp4 family protein | - |
| LU633_RS01740 (LU633_01740) | - | 348489..350258 (+) | 1770 | WP_407647023.1 | packaged DNA stabilization protein | - |
| LU633_RS01745 (LU633_01745) | - | 350251..350745 (+) | 495 | WP_046372156.1 | hypothetical protein | - |
| LU633_RS01750 (LU633_01750) | - | 350748..351110 (+) | 363 | WP_020323013.1 | hypothetical protein | - |
| LU633_RS01755 (LU633_01755) | - | 351112..351696 (+) | 585 | WP_020323012.1 | hypothetical protein | - |
| LU633_RS01760 (LU633_01760) | - | 351696..352985 (+) | 1290 | WP_020323011.1 | phage DNA ejection protein | - |
| LU633_RS01765 (LU633_01765) | - | 352985..355111 (+) | 2127 | WP_020323010.1 | hypothetical protein | - |
| LU633_RS01770 (LU633_01770) | - | 355826..356623 (-) | 798 | WP_020323008.1 | BRO family protein | - |
| LU633_RS01775 (LU633_01775) | - | 356679..356825 (+) | 147 | WP_198292519.1 | hypothetical protein | - |
| LU633_RS01780 (LU633_01780) | - | 356971..358242 (+) | 1272 | WP_052734726.1 | phage tailspike protein | - |
| LU633_RS01785 (LU633_01785) | - | 358272..358598 (-) | 327 | WP_016191793.1 | DUF1493 family protein | - |
| LU633_RS01790 (LU633_01790) | - | 358592..359038 (-) | 447 | WP_020323001.1 | STM2901 family protein | - |
| LU633_RS01795 (LU633_01795) | - | 359104..360201 (-) | 1098 | WP_020323000.1 | site-specific integrase | - |
| LU633_RS01800 (LU633_01800) | dusA | 360291..361340 (+) | 1050 | WP_020322999.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| LU633_RS01805 (LU633_01805) | - | 362000..362697 (+) | 698 | WP_233481982.1 | IS1 family transposase | - |
| LU633_RS01810 (LU633_01810) | pspG | 363416..363628 (+) | 213 | WP_040465462.1 | envelope stress response protein PspG | - |
| LU633_RS01815 (LU633_01815) | - | 363872..364852 (-) | 981 | WP_020322995.1 | quinone oxidoreductase | - |
| LU633_RS01820 (LU633_01820) | dnaB | 364954..366369 (+) | 1416 | WP_020322994.1 | replicative DNA helicase | - |
| LU633_RS01825 (LU633_01825) | - | 366462..367159 (+) | 698 | WP_233481983.1 | IS1 family transposase | - |
| LU633_RS01830 (LU633_01830) | - | 367437..367937 (+) | 501 | WP_020322993.1 | exochitinase | - |
| LU633_RS01835 (LU633_01835) | - | 368089..370008 (+) | 1920 | WP_020322992.1 | S8 family serine peptidase | - |
| LU633_RS01840 (LU633_01840) | - | 370480..370885 (+) | 406 | Protein_356 | Lrp/AsnC family transcriptional regulator | - |
| LU633_RS01845 (LU633_01845) | tnpA | 371055..371492 (+) | 438 | WP_046372172.1 | IS200/IS605 family transposase | - |
| LU633_RS01850 (LU633_01850) | - | 371777..372383 (+) | 607 | Protein_358 | YitT family protein | - |
| LU633_RS01855 (LU633_01855) | - | 372442..373635 (+) | 1194 | WP_020322990.1 | amino acid aminotransferase | - |
| LU633_RS01860 (LU633_01860) | - | 373936..374348 (+) | 413 | Protein_360 | secondary thiamine-phosphate synthase enzyme YjbQ | - |
| LU633_RS01865 (LU633_01865) | - | 374386..374686 (+) | 301 | Protein_361 | MmcQ/YjbR family DNA-binding protein | - |
| LU633_RS01870 (LU633_01870) | - | 374964..376016 (-) | 1053 | WP_020322986.1 | NAD(P)-dependent alcohol dehydrogenase | - |
| LU633_RS01875 (LU633_01875) | uvrA | 376379..379204 (-) | 2826 | WP_020322985.1 | excinuclease ABC subunit UvrA | - |
| LU633_RS01880 (LU633_01880) | ssb | 379507..380043 (+) | 537 | WP_020322984.1 | single-stranded DNA-binding protein SSB1 | Machinery gene |
| LU633_RS25680 | - | 380607..381191 (+) | 585 | WP_020322983.1 | reverse transcriptase domain-containing protein | - |
| LU633_RS25685 | - | 381124..381717 (+) | 594 | WP_198292518.1 | reverse transcriptase domain-containing protein | - |
| LU633_RS01890 (LU633_01890) | - | 381828..383036 (+) | 1209 | WP_046371917.1 | IS256 family transposase | - |
| LU633_RS01895 (LU633_01895) | - | 383121..384443 (+) | 1323 | WP_046371900.1 | IS4 family transposase | - |
| LU633_RS26060 | - | 384497..384583 (+) | 87 | WP_407647024.1 | hypothetical protein | - |
| LU633_RS01900 (LU633_01900) | - | 384819..385043 (-) | 225 | Protein_370 | transposase | - |
| LU633_RS01905 (LU633_01905) | - | 385102..386142 (-) | 1041 | WP_046371791.1 | IS481 family transposase | - |
| LU633_RS01910 (LU633_01910) | - | 386246..387235 (-) | 990 | Protein_372 | IS256 family transposase | - |
| LU633_RS01915 (LU633_01915) | - | 387664..388311 (+) | 648 | Protein_373 | IS6 family transposase | - |
Sequence
Protein
Download Length: 178 a.a. Molecular weight: 19080.03 Da Isoelectric Point: 5.2456
>NTDB_id=639222 LU633_RS01880 WP_020322984.1 379507..380043(+) (ssb) [Erwinia tracheiphila strain BHKY]
MASRGINKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQTGETKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGALQTRKWTDQAGVEKYTTEVVVNVGGTMQMLGGRQGGGAQAGGNNQGNNNGWGQPQQPQGGNQFSGGGQASRPQSQQN
SAPISNEPPMDFDDDIPF
MASRGINKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKQTGETKEKTEWHRVVLFGKLAEVAGEYLRKGSQVYI
EGALQTRKWTDQAGVEKYTTEVVVNVGGTMQMLGGRQGGGAQAGGNNQGNNNGWGQPQQPQGGNQFSGGGQASRPQSQQN
SAPISNEPPMDFDDDIPF
Nucleotide
Download Length: 537 bp
>NTDB_id=639222 LU633_RS01880 WP_020322984.1 379507..380043(+) (ssb) [Erwinia tracheiphila strain BHKY]
ATGGCCAGCAGAGGCATAAATAAAGTGATCCTGGTAGGCAACCTGGGTCAGGATCCTGAAGTCCGTTACATGCCGAATGG
CGGTGCTGTTGCCAATATCACTCTGGCTACCTCTGAAAGCTGGCGTGACAAACAGACTGGTGAAACTAAAGAGAAAACAG
AATGGCATCGCGTGGTGCTGTTTGGAAAGCTTGCTGAAGTGGCGGGCGAATATCTGCGCAAAGGTTCTCAGGTTTATATT
GAGGGTGCGCTTCAGACGCGTAAATGGACCGATCAGGCAGGCGTTGAGAAATACACCACAGAAGTGGTTGTTAACGTTGG
TGGCACCATGCAGATGCTGGGTGGCCGCCAGGGCGGCGGTGCGCAGGCTGGTGGTAATAACCAGGGTAATAATAACGGCT
GGGGTCAGCCTCAGCAGCCGCAGGGCGGCAACCAGTTCAGCGGCGGCGGTCAGGCGTCACGGCCACAGTCACAGCAAAAC
AGCGCACCCATCAGCAATGAACCGCCGATGGATTTTGACGACGATATCCCGTTTTGA
ATGGCCAGCAGAGGCATAAATAAAGTGATCCTGGTAGGCAACCTGGGTCAGGATCCTGAAGTCCGTTACATGCCGAATGG
CGGTGCTGTTGCCAATATCACTCTGGCTACCTCTGAAAGCTGGCGTGACAAACAGACTGGTGAAACTAAAGAGAAAACAG
AATGGCATCGCGTGGTGCTGTTTGGAAAGCTTGCTGAAGTGGCGGGCGAATATCTGCGCAAAGGTTCTCAGGTTTATATT
GAGGGTGCGCTTCAGACGCGTAAATGGACCGATCAGGCAGGCGTTGAGAAATACACCACAGAAGTGGTTGTTAACGTTGG
TGGCACCATGCAGATGCTGGGTGGCCGCCAGGGCGGCGGTGCGCAGGCTGGTGGTAATAACCAGGGTAATAATAACGGCT
GGGGTCAGCCTCAGCAGCCGCAGGGCGGCAACCAGTTCAGCGGCGGCGGTCAGGCGTCACGGCCACAGTCACAGCAAAAC
AGCGCACCCATCAGCAATGAACCGCCGATGGATTTTGACGACGATATCCCGTTTTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
71.978 |
100 |
0.736 |
| ssb | Glaesserella parasuis strain SC1401 |
55.738 |
100 |
0.573 |
| ssb | Neisseria meningitidis MC58 |
43.716 |
100 |
0.449 |
| ssb | Neisseria gonorrhoeae MS11 |
43.094 |
100 |
0.438 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
38.764 |
100 |
0.388 |