Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   LOZ87_RS11765 Genome accession   NZ_CP087391
Coordinates   2437945..2438382 (-) Length   145 a.a.
NCBI ID   WP_007408322.1    Uniprot ID   -
Organism   Bacillus amyloliquefaciens strain ZF57     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2432945..2443382
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LOZ87_RS11715 (LOZ87_11715) sinI 2433329..2433502 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LOZ87_RS11720 (LOZ87_11720) sinR 2433536..2433871 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LOZ87_RS11725 (LOZ87_11725) tasA 2433919..2434704 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LOZ87_RS11730 (LOZ87_11730) sipW 2434769..2435353 (-) 585 WP_007408328.1 signal peptidase I SipW -
  LOZ87_RS11735 (LOZ87_11735) tapA 2435325..2435996 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  LOZ87_RS11740 (LOZ87_11740) - 2436255..2436584 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  LOZ87_RS11745 (LOZ87_11745) - 2436624..2436803 (-) 180 WP_003153093.1 YqzE family protein -
  LOZ87_RS11750 (LOZ87_11750) comGG 2436860..2437237 (-) 378 WP_039063315.1 competence type IV pilus minor pilin ComGG -
  LOZ87_RS11755 (LOZ87_11755) comGF 2437238..2437738 (-) 501 WP_258038902.1 competence type IV pilus minor pilin ComGF -
  LOZ87_RS11760 (LOZ87_11760) comGE 2437647..2437961 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  LOZ87_RS11765 (LOZ87_11765) comGD 2437945..2438382 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  LOZ87_RS11770 (LOZ87_11770) comGC 2438372..2438680 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  LOZ87_RS11775 (LOZ87_11775) comGB 2438685..2439722 (-) 1038 WP_039063317.1 competence type IV pilus assembly protein ComGB Machinery gene
  LOZ87_RS11780 (LOZ87_11780) comGA 2439709..2440779 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  LOZ87_RS11785 (LOZ87_11785) - 2440972..2441922 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -
  LOZ87_RS11790 (LOZ87_11790) - 2442068..2443369 (+) 1302 WP_039063318.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16314.79 Da        Isoelectric Point: 10.2475

>NTDB_id=629276 LOZ87_RS11765 WP_007408322.1 2437945..2438382(-) (comGD) [Bacillus amyloliquefaciens strain ZF57]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=629276 LOZ87_RS11765 WP_007408322.1 2437945..2438382(-) (comGD) [Bacillus amyloliquefaciens strain ZF57]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCTTTTGACTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566