Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | LOZ87_RS11715 | Genome accession | NZ_CP087391 |
| Coordinates | 2433329..2433502 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus amyloliquefaciens strain ZF57 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2428329..2438502
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LOZ87_RS11700 (LOZ87_11700) | gcvT | 2429142..2430242 (-) | 1101 | WP_039063314.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| LOZ87_RS11705 (LOZ87_11705) | - | 2430666..2432336 (+) | 1671 | WP_007408331.1 | DEAD/DEAH box helicase | - |
| LOZ87_RS11710 (LOZ87_11710) | - | 2432358..2433152 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| LOZ87_RS11715 (LOZ87_11715) | sinI | 2433329..2433502 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| LOZ87_RS11720 (LOZ87_11720) | sinR | 2433536..2433871 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| LOZ87_RS11725 (LOZ87_11725) | tasA | 2433919..2434704 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| LOZ87_RS11730 (LOZ87_11730) | sipW | 2434769..2435353 (-) | 585 | WP_007408328.1 | signal peptidase I SipW | - |
| LOZ87_RS11735 (LOZ87_11735) | tapA | 2435325..2435996 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| LOZ87_RS11740 (LOZ87_11740) | - | 2436255..2436584 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| LOZ87_RS11745 (LOZ87_11745) | - | 2436624..2436803 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| LOZ87_RS11750 (LOZ87_11750) | comGG | 2436860..2437237 (-) | 378 | WP_039063315.1 | competence type IV pilus minor pilin ComGG | - |
| LOZ87_RS11755 (LOZ87_11755) | comGF | 2437238..2437738 (-) | 501 | WP_258038902.1 | competence type IV pilus minor pilin ComGF | - |
| LOZ87_RS11760 (LOZ87_11760) | comGE | 2437647..2437961 (-) | 315 | WP_012117982.1 | competence type IV pilus minor pilin ComGE | - |
| LOZ87_RS11765 (LOZ87_11765) | comGD | 2437945..2438382 (-) | 438 | WP_007408322.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=629274 LOZ87_RS11715 WP_003153105.1 2433329..2433502(+) (sinI) [Bacillus amyloliquefaciens strain ZF57]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=629274 LOZ87_RS11715 WP_003153105.1 2433329..2433502(+) (sinI) [Bacillus amyloliquefaciens strain ZF57]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |