Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   LOZ87_RS11715 Genome accession   NZ_CP087391
Coordinates   2433329..2433502 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus amyloliquefaciens strain ZF57     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2428329..2438502
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LOZ87_RS11700 (LOZ87_11700) gcvT 2429142..2430242 (-) 1101 WP_039063314.1 glycine cleavage system aminomethyltransferase GcvT -
  LOZ87_RS11705 (LOZ87_11705) - 2430666..2432336 (+) 1671 WP_007408331.1 DEAD/DEAH box helicase -
  LOZ87_RS11710 (LOZ87_11710) - 2432358..2433152 (+) 795 WP_007408330.1 YqhG family protein -
  LOZ87_RS11715 (LOZ87_11715) sinI 2433329..2433502 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  LOZ87_RS11720 (LOZ87_11720) sinR 2433536..2433871 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  LOZ87_RS11725 (LOZ87_11725) tasA 2433919..2434704 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  LOZ87_RS11730 (LOZ87_11730) sipW 2434769..2435353 (-) 585 WP_007408328.1 signal peptidase I SipW -
  LOZ87_RS11735 (LOZ87_11735) tapA 2435325..2435996 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  LOZ87_RS11740 (LOZ87_11740) - 2436255..2436584 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  LOZ87_RS11745 (LOZ87_11745) - 2436624..2436803 (-) 180 WP_003153093.1 YqzE family protein -
  LOZ87_RS11750 (LOZ87_11750) comGG 2436860..2437237 (-) 378 WP_039063315.1 competence type IV pilus minor pilin ComGG -
  LOZ87_RS11755 (LOZ87_11755) comGF 2437238..2437738 (-) 501 WP_258038902.1 competence type IV pilus minor pilin ComGF -
  LOZ87_RS11760 (LOZ87_11760) comGE 2437647..2437961 (-) 315 WP_012117982.1 competence type IV pilus minor pilin ComGE -
  LOZ87_RS11765 (LOZ87_11765) comGD 2437945..2438382 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=629274 LOZ87_RS11715 WP_003153105.1 2433329..2433502(+) (sinI) [Bacillus amyloliquefaciens strain ZF57]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=629274 LOZ87_RS11715 WP_003153105.1 2433329..2433502(+) (sinI) [Bacillus amyloliquefaciens strain ZF57]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-37)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702