NTDB

Overview

Name	ssb	Type	Machinery gene
Locus tag	LO773_RS00675	Genome accession	NZ_CP087380
Coordinates	140488..140940 (+)	Length	150 a.a.
NCBI ID	WP_012340854.1	Uniprot ID	W0R5B1
Organism	Pasteurella multocida strain IMT47951
Function	ssDNA binding (predicted from homology) DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	141476..151096	140488..140940	flank	536

Gene organization within MGE regions

Location: 140488..151096

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
LO773_RS00675 (LO773_00675)	ssb	140488..140940 (+)	453	WP_012340854.1	single-stranded DNA-binding protein	Machinery gene
LO773_RS00680	-	141247..141435 (+)	189	WP_011200812.1	hypothetical protein	-
LO773_RS00685 (LO773_00685)	-	141542..141778 (+)	237	WP_230294061.1	hypothetical protein	-
LO773_RS00690 (LO773_00690)	-	141778..143088 (+)	1311	WP_011200814.1	ISL3 family transposase	-
LO773_RS00695 (LO773_00695)	tet(H)	143184..144386 (-)	1203	WP_230294065.1	tetracycline efflux MFS transporter Tet(H)	-
LO773_RS00700 (LO773_00700)	tetR(H)	144478..145101 (+)	624	WP_006248868.1	tetracycline resistance transcriptional repressor TetR(H)	-
LO773_RS00705 (LO773_00705)	-	145104..145622 (-)	519	WP_006248869.1	hypothetical protein	-
LO773_RS00710 (LO773_00710)	-	145671..145850 (-)	180	WP_006248870.1	hypothetical protein	-
LO773_RS00715 (LO773_00715)	-	145960..146094 (+)	135	WP_015587091.1	alcohol dehydrogenase catalytic domain-containing protein	-
LO773_RS00720 (LO773_00720)	-	146184..147731 (-)	1548	WP_006248871.1	multicopper oxidase family protein	-
LO773_RS00725 (LO773_00725)	-	147744..148199 (-)	456	WP_005612095.1	DUF411 domain-containing protein	-
LO773_RS00730 (LO773_00730)	-	148381..148797 (-)	417	WP_316244961.1	DUF6803 family protein	-
LO773_RS00735 (LO773_00735)	-	148700..149467 (+)	768	WP_012340839.1	aldo/keto reductase	-
LO773_RS00740 (LO773_00740)	-	150006..150716 (-)	711	WP_006248874.1	hypothetical protein	-

Sequence

Protein

Download Length: 150 a.a. Molecular weight: 17204.13 Da Isoelectric Point: 5.2733

                                >NTDB_id=629188 LO773_RS00675 WP_012340854.1 140488..140940(+) (ssb) [Pasteurella multocida strain IMT47951]

MAGINKVIIVGNLGNDPEMRTMPNGEAVANISVATSESWTDKNTGERREVTEWHRIVFYRRYAEICGQYLRKGSKIYIEG

KLRTRKWQDQNGQERYTTEIQGELLQMLDSRNATNSVDGQQSNYQAMSQSPKATHPQDLPMDNFDDDIPF

Nucleotide

Download Length: 453 bp

                                >NTDB_id=629188 LO773_RS00675 WP_012340854.1 140488..140940(+) (ssb) [Pasteurella multocida strain IMT47951]

ATGGCAGGAATCAATAAAGTGATTATTGTCGGTAATCTTGGCAACGATCCTGAAATGCGGACTATGCCTAATGGTGAAGC

AGTTGCTAATATTAGTGTGGCAACTTCTGAAAGTTGGACGGATAAAAATACCGGAGAACGTCGAGAAGTCACTGAATGGC

ATCGTATCGTTTTTTATCGCCGTTATGCTGAAATTTGTGGTCAGTACCTACGTAAAGGCTCTAAAATTTATATCGAAGGA

AAATTACGGACACGTAAGTGGCAAGACCAAAACGGGCAAGAGCGTTATACAACCGAAATCCAAGGTGAACTATTACAAAT

GTTAGATAGCCGTAATGCTACAAATAGCGTAGATGGACAACAATCTAACTATCAAGCTATGAGCCAATCTCCAAAAGCAA

CACATCCACAAGATTTACCAATGGATAACTTTGATGATGATATTCCGTTCTGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(4-108)

Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.

3D structure

Source	ID	Structure
AlphaFold DB	W0R5B1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.

Visualization of predicted probability:

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	H_a-value
ssb	Glaesserella parasuis strain SC1401	63.333	100	0.76
ssb	Vibrio cholerae strain A1552	51.724	100	0.6
ssb	Neisseria gonorrhoeae MS11	45.665	100	0.527
ssb	Neisseria meningitidis MC58	45.087	100	0.52
ssbA	Bacillus subtilis subsp. subtilis str. 168	31.818	100	0.373

Detailed information NTG0629188