Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   K748_RS04000 Genome accession   NC_021882
Coordinates   813453..813578 (+) Length   41 a.a.
NCBI ID   WP_020849792.1    Uniprot ID   -
Organism   Helicobacter pylori UM298     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 808453..818578
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  K748_RS03975 (K748_05415) - 808513..810735 (+) 2223 WP_015645811.1 ATP-dependent Clp protease ATP-binding subunit -
  K748_RS03980 (K748_05420) panD 810725..811075 (+) 351 WP_015645812.1 aspartate 1-decarboxylase -
  K748_RS03985 (K748_05425) - 811086..811379 (+) 294 WP_000347916.1 YbaB/EbfC family nucleoid-associated protein -
  K748_RS03990 (K748_05430) - 811379..812374 (+) 996 WP_015645813.1 PDZ domain-containing protein -
  K748_RS03995 (K748_05435) comB6 812382..813437 (+) 1056 WP_015645814.1 P-type conjugative transfer protein TrbL Machinery gene
  K748_RS04000 comB7 813453..813578 (+) 126 WP_020849792.1 hypothetical protein Machinery gene
  K748_RS04005 (K748_05445) comB8 813575..814318 (+) 744 WP_015645815.1 virB8 family protein Machinery gene
  K748_RS04010 (K748_05450) comB9 814318..815313 (+) 996 WP_015645816.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  K748_RS04015 (K748_05455) comB10 815306..816442 (+) 1137 WP_015645817.1 DNA type IV secretion system protein ComB10 Machinery gene
  K748_RS04020 (K748_05460) - 816508..817920 (+) 1413 WP_015645818.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence

Protein


Download         Length: 41 a.a.        Molecular weight: 4699.69 Da        Isoelectric Point: 8.5447

>NTDB_id=60671 K748_RS04000 WP_020849792.1 813453..813578(+) (comB7) [Helicobacter pylori UM298]
MRIFFVIMGLVLFGCTSKVHEMKKSPCTLHEKLYENGLNLA

Nucleotide


Download         Length: 126 bp        

>NTDB_id=60671 K748_RS04000 WP_020849792.1 813453..813578(+) (comB7) [Helicobacter pylori UM298]
ATGAGAATTTTTTTTGTCATTATGGGACTAGTATTGTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGCATGAAAAGTTATATGAAAACGGGTTGAATCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

85.366

100

0.854

Multiple sequence alignment