Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | K6972_RS01010 | Genome accession | NZ_CP082203 |
| Coordinates | 159461..159646 (+) | Length | 61 a.a. |
| NCBI ID | WP_016056161.1 | Uniprot ID | A0AAJ2PHW3 |
| Organism | Streptococcus suis strain NJ3 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 122430..159646 | 159461..159646 | within | 0 |
Gene organization within MGE regions
Location: 122430..159646
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K6972_RS00760 (K6972_00760) | - | 122430..123869 (-) | 1440 | WP_016056215.1 | recombinase family protein | - |
| K6972_RS00765 (K6972_00765) | - | 124003..124572 (-) | 570 | WP_222812621.1 | hypothetical protein | - |
| K6972_RS00770 (K6972_00770) | - | 124586..125302 (-) | 717 | WP_222812623.1 | S24 family peptidase | - |
| K6972_RS00775 (K6972_00775) | - | 125550..125774 (+) | 225 | WP_105116292.1 | DUF739 family protein | - |
| K6972_RS00780 (K6972_00780) | - | 125879..126052 (+) | 174 | WP_016056211.1 | hypothetical protein | - |
| K6972_RS10715 | - | 126028..126174 (+) | 147 | WP_202846486.1 | BOW99_gp33 family protein | - |
| K6972_RS00785 (K6972_00785) | - | 126217..126534 (+) | 318 | WP_016056209.1 | hypothetical protein | - |
| K6972_RS00790 (K6972_00790) | - | 126786..127361 (+) | 576 | WP_016056208.1 | hypothetical protein | - |
| K6972_RS00795 (K6972_00795) | - | 127365..128063 (+) | 699 | WP_016056207.1 | ERF family protein | - |
| K6972_RS00800 (K6972_00800) | - | 128078..128404 (+) | 327 | WP_016056206.1 | hypothetical protein | - |
| K6972_RS00805 (K6972_00805) | - | 128415..129476 (+) | 1062 | WP_016056205.1 | DUF1351 domain-containing protein | - |
| K6972_RS00810 (K6972_00810) | - | 129466..129987 (+) | 522 | WP_016056204.1 | MazG-like family protein | - |
| K6972_RS00815 (K6972_00815) | - | 129998..130198 (+) | 201 | WP_105135895.1 | hypothetical protein | - |
| K6972_RS00820 (K6972_00820) | ssbA | 130188..130700 (+) | 513 | WP_016056202.1 | single-stranded DNA-binding protein | Machinery gene |
| K6972_RS00825 (K6972_00825) | - | 130716..130994 (+) | 279 | WP_016056201.1 | hypothetical protein | - |
| K6972_RS00830 (K6972_00830) | - | 131008..131787 (+) | 780 | WP_222812625.1 | DNA methyltransferase | - |
| K6972_RS00835 (K6972_00835) | - | 131984..132418 (+) | 435 | WP_016056198.1 | helix-turn-helix domain-containing protein | - |
| K6972_RS00840 (K6972_00840) | - | 132429..132866 (+) | 438 | WP_016056197.1 | hypothetical protein | - |
| K6972_RS00845 (K6972_00845) | - | 132868..133605 (+) | 738 | WP_016056196.1 | hypothetical protein | - |
| K6972_RS00850 (K6972_00850) | - | 133625..134011 (+) | 387 | WP_016056195.1 | hypothetical protein | - |
| K6972_RS00855 (K6972_00855) | - | 134137..134439 (+) | 303 | WP_016056193.1 | DUF1372 family protein | - |
| K6972_RS00860 (K6972_00860) | - | 134440..134616 (+) | 177 | WP_016056192.1 | hypothetical protein | - |
| K6972_RS00865 (K6972_00865) | - | 134623..134853 (+) | 231 | WP_016056191.1 | hypothetical protein | - |
| K6972_RS00870 (K6972_00870) | - | 134850..135269 (+) | 420 | WP_016056190.1 | hypothetical protein | - |
| K6972_RS00875 (K6972_00875) | - | 135253..135645 (+) | 393 | WP_016056189.1 | putative yopX protein | - |
| K6972_RS00880 (K6972_00880) | - | 135642..136022 (+) | 381 | WP_016056188.1 | hypothetical protein | - |
| K6972_RS00885 (K6972_00885) | - | 136090..136761 (+) | 672 | WP_016056187.1 | DUF4417 domain-containing protein | - |
| K6972_RS00890 (K6972_00890) | - | 136758..137141 (+) | 384 | WP_016056186.1 | hypothetical protein | - |
| K6972_RS00895 (K6972_00895) | - | 137333..137812 (+) | 480 | WP_016056185.1 | terminase small subunit | - |
| K6972_RS00900 (K6972_00900) | - | 137799..139112 (+) | 1314 | WP_016056184.1 | PBSX family phage terminase large subunit | - |
| K6972_RS00905 (K6972_00905) | - | 139125..140708 (+) | 1584 | WP_016056183.1 | phage portal protein | - |
| K6972_RS00910 (K6972_00910) | - | 140711..141862 (+) | 1152 | WP_016056182.1 | phage minor capsid protein | - |
| K6972_RS00915 (K6972_00915) | - | 142009..142626 (+) | 618 | WP_016056181.1 | phage scaffolding protein | - |
| K6972_RS00920 (K6972_00920) | - | 142630..143469 (+) | 840 | WP_016056180.1 | N4-gp56 family major capsid protein | - |
| K6972_RS00925 (K6972_00925) | - | 143469..143654 (+) | 186 | WP_016056179.1 | Rho termination factor N-terminal domain-containing protein | - |
| K6972_RS00930 (K6972_00930) | - | 143632..143859 (+) | 228 | WP_016056178.1 | hypothetical protein | - |
| K6972_RS00935 (K6972_00935) | - | 143901..144296 (+) | 396 | WP_016056177.1 | hypothetical protein | - |
| K6972_RS00940 (K6972_00940) | - | 144286..144612 (+) | 327 | WP_016056176.1 | putative minor capsid protein | - |
| K6972_RS00945 (K6972_00945) | - | 144612..144962 (+) | 351 | WP_016056175.1 | minor capsid protein | - |
| K6972_RS00950 (K6972_00950) | - | 144964..145371 (+) | 408 | WP_016056174.1 | minor capsid protein | - |
| K6972_RS00955 (K6972_00955) | - | 145375..145833 (+) | 459 | WP_016056173.1 | phage tail tube protein | - |
| K6972_RS00960 (K6972_00960) | - | 145855..146223 (+) | 369 | WP_016056172.1 | hypothetical protein | - |
| K6972_RS00965 (K6972_00965) | - | 146223..146810 (+) | 588 | WP_105116263.1 | Gp15 family bacteriophage protein | - |
| K6972_RS00970 (K6972_00970) | - | 146830..150117 (+) | 3288 | WP_222812626.1 | hypothetical protein | - |
| K6972_RS00975 (K6972_00975) | - | 150114..151616 (+) | 1503 | WP_016056168.1 | distal tail protein Dit | - |
| K6972_RS00980 (K6972_00980) | - | 151616..155425 (+) | 3810 | WP_016056167.1 | phage tail spike protein | - |
| K6972_RS00985 (K6972_00985) | - | 155439..157502 (+) | 2064 | WP_016056166.1 | DUF859 family phage minor structural protein | - |
| K6972_RS00990 (K6972_00990) | - | 157564..157827 (+) | 264 | WP_024410576.1 | hypothetical protein | - |
| K6972_RS00995 (K6972_00995) | - | 157840..158295 (+) | 456 | WP_016056164.1 | hypothetical protein | - |
| K6972_RS01000 (K6972_01000) | - | 158270..158473 (+) | 204 | WP_016056163.1 | putative holin protein | - |
| K6972_RS01005 (K6972_01005) | - | 158603..159313 (+) | 711 | WP_016056162.1 | CHAP domain-containing protein | - |
| K6972_RS01010 (K6972_01010) | prx | 159461..159646 (+) | 186 | WP_016056161.1 | hypothetical protein | Regulator |
Sequence
Protein
Download Length: 61 a.a. Molecular weight: 7128.08 Da Isoelectric Point: 4.1947
>NTDB_id=599915 K6972_RS01010 WP_016056161.1 159461..159646(+) (prx) [Streptococcus suis strain NJ3]
MSETYYIFVEGIENGWFSDFVQVVRKDGKIFDFVLPGEKVQPHEVVSIEKLDDVIKEISNY
MSETYYIFVEGIENGWFSDFVQVVRKDGKIFDFVLPGEKVQPHEVVSIEKLDDVIKEISNY
Nucleotide
Download Length: 186 bp
>NTDB_id=599915 K6972_RS01010 WP_016056161.1 159461..159646(+) (prx) [Streptococcus suis strain NJ3]
GTGAGTGAAACGTATTATATTTTTGTAGAGGGCATTGAAAATGGTTGGTTTAGTGATTTTGTACAGGTTGTGAGAAAAGA
CGGTAAAATATTTGATTTTGTATTGCCTGGCGAAAAAGTACAGCCACATGAGGTTGTGAGCATCGAGAAATTGGATGATG
TTATTAAAGAGATTTCCAACTATTAA
GTGAGTGAAACGTATTATATTTTTGTAGAGGGCATTGAAAATGGTTGGTTTAGTGATTTTGTACAGGTTGTGAGAAAAGA
CGGTAAAATATTTGATTTTGTATTGCCTGGCGAAAAAGTACAGCCACATGAGGTTGTGAGCATCGAGAAATTGGATGATG
TTATTAAAGAGATTTCCAACTATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS8232 |
51.724 |
95.082 |
0.492 |
| prx | Streptococcus pyogenes MGAS315 |
45.614 |
93.443 |
0.426 |
| prx | Streptococcus pyogenes MGAS315 |
44.643 |
91.803 |
0.41 |
| prx | Streptococcus pyogenes MGAS315 |
42.857 |
91.803 |
0.393 |
| prx | Streptococcus pyogenes MGAS315 |
57.5 |
65.574 |
0.377 |