Detailed information
Bioinformatically predicted
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | KWY95_RS06045 | Genome accession | NZ_CP078117 |
| Coordinates | 1150916..1151389 (+) | Length | 157 a.a. |
| NCBI ID | WP_025456240.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain SK92679 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1151459..1189969 | 1150916..1151389 | flank | 70 |
Gene organization within MGE regions
Location: 1150916..1189969
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KWY95_RS06045 (KWY95_06045) | pilL | 1150916..1151389 (+) | 474 | WP_025456240.1 | PilX family type IV pilin | Machinery gene |
| KWY95_RS06050 (KWY95_06050) | - | 1151459..1151767 (-) | 309 | WP_025456241.1 | AzlD family protein | - |
| KWY95_RS06055 (KWY95_06055) | - | 1151764..1152475 (-) | 712 | Protein_1163 | AzlC family ABC transporter permease | - |
| KWY95_RS06060 (KWY95_06060) | dut | 1152641..1153093 (+) | 453 | WP_003701071.1 | dUTP diphosphatase | - |
| KWY95_RS06065 (KWY95_06065) | dapC | 1153165..1154352 (+) | 1188 | WP_003701073.1 | succinyldiaminopimelate transaminase | - |
| KWY95_RS06070 (KWY95_06070) | yaaA | 1154508..1155287 (+) | 780 | WP_003687925.1 | peroxide stress protein YaaA | - |
| KWY95_RS06085 (KWY95_06085) | - | 1155817..1157017 (+) | 1201 | Protein_1167 | tyrosine-type recombinase/integrase | - |
| KWY95_RS06095 (KWY95_06095) | - | 1157373..1157642 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| KWY95_RS06100 (KWY95_06100) | - | 1157837..1158520 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| KWY95_RS11900 | - | 1158834..1159067 (-) | 234 | Protein_1170 | hypothetical protein | - |
| KWY95_RS06110 (KWY95_06110) | - | 1159178..1159393 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| KWY95_RS06115 (KWY95_06115) | - | 1159445..1159936 (-) | 492 | WP_017147227.1 | siphovirus Gp157 family protein | - |
| KWY95_RS06120 (KWY95_06120) | - | 1159933..1160115 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| KWY95_RS06125 (KWY95_06125) | - | 1160255..1160941 (-) | 687 | WP_010359969.1 | phage replication initiation protein, NGO0469 family | - |
| KWY95_RS06130 (KWY95_06130) | - | 1161010..1161171 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| KWY95_RS06135 (KWY95_06135) | - | 1161168..1161443 (-) | 276 | WP_050154389.1 | NGO1622 family putative holin | - |
| KWY95_RS06140 (KWY95_06140) | - | 1161596..1161928 (-) | 333 | WP_003696914.1 | hypothetical protein | - |
| KWY95_RS06145 (KWY95_06145) | - | 1162069..1162344 (-) | 276 | WP_218423491.1 | hypothetical protein | - |
| KWY95_RS06150 (KWY95_06150) | - | 1162341..1162817 (-) | 477 | WP_003691526.1 | hypothetical protein | - |
| KWY95_RS06155 (KWY95_06155) | - | 1162850..1163050 (-) | 201 | WP_003704298.1 | hypothetical protein | - |
| KWY95_RS06160 (KWY95_06160) | - | 1163248..1163661 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| KWY95_RS06165 (KWY95_06165) | - | 1163658..1164119 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| KWY95_RS06170 (KWY95_06170) | - | 1164136..1164573 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| KWY95_RS06175 (KWY95_06175) | - | 1164686..1165402 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| KWY95_RS06180 (KWY95_06180) | - | 1165471..1165707 (+) | 237 | WP_003687971.1 | Cro/CI family transcriptional regulator | - |
| KWY95_RS06185 (KWY95_06185) | - | 1165787..1165942 (+) | 156 | WP_003698902.1 | hypothetical protein | - |
| KWY95_RS06190 (KWY95_06190) | - | 1165919..1166107 (-) | 189 | WP_050157615.1 | hypothetical protein | - |
| KWY95_RS06195 (KWY95_06195) | - | 1166280..1166507 (+) | 228 | WP_050158909.1 | helix-turn-helix domain-containing protein | - |
| KWY95_RS06200 (KWY95_06200) | - | 1166504..1166641 (+) | 138 | WP_170309797.1 | hypothetical protein | - |
| KWY95_RS11505 | - | 1167186..1167689 (+) | 504 | WP_010360005.1 | hypothetical protein | - |
| KWY95_RS06210 (KWY95_06210) | - | 1167686..1169047 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| KWY95_RS06215 (KWY95_06215) | - | 1169084..1169347 (+) | 264 | WP_154230797.1 | hypothetical protein | - |
| KWY95_RS06220 (KWY95_06220) | - | 1169386..1169880 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| KWY95_RS06225 (KWY95_06225) | - | 1170057..1170206 (+) | 150 | WP_003692854.1 | hypothetical protein | - |
| KWY95_RS11510 | - | 1170235..1170516 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| KWY95_RS06230 (KWY95_06230) | - | 1170507..1170944 (+) | 438 | WP_232038206.1 | RusA family crossover junction endodeoxyribonuclease | - |
| KWY95_RS06235 (KWY95_06235) | - | 1170937..1171242 (+) | 306 | WP_003687981.1 | nuclease domain-containing protein | - |
| KWY95_RS06240 (KWY95_06240) | - | 1171239..1171622 (+) | 384 | WP_003690918.1 | recombination protein NinB | - |
| KWY95_RS06245 (KWY95_06245) | - | 1171613..1172131 (+) | 519 | WP_003687984.1 | HNH endonuclease | - |
| KWY95_RS06250 (KWY95_06250) | - | 1172196..1172618 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| KWY95_RS11515 | - | 1172618..1173157 (+) | 540 | WP_003690920.1 | hypothetical protein | - |
| KWY95_RS06265 (KWY95_06265) | - | 1173138..1174412 (+) | 1275 | WP_003701186.1 | PBSX family phage terminase large subunit | - |
| KWY95_RS06270 (KWY95_06270) | - | 1174397..1176664 (+) | 2268 | WP_225577699.1 | hypothetical protein | - |
| KWY95_RS06275 (KWY95_06275) | - | 1176901..1178097 (+) | 1197 | WP_003690925.1 | hypothetical protein | - |
| KWY95_RS06280 (KWY95_06280) | - | 1178094..1178561 (+) | 468 | WP_003701187.1 | hypothetical protein | - |
| KWY95_RS06285 (KWY95_06285) | - | 1178548..1179120 (+) | 573 | WP_169301118.1 | hypothetical protein | - |
| KWY95_RS11520 | - | 1182107..1185211 (+) | 3105 | Protein_1207 | PLxRFG domain-containing protein | - |
| KWY95_RS11525 | - | 1185193..1185930 (+) | 738 | WP_003701191.1 | hypothetical protein | - |
| KWY95_RS06295 (KWY95_06295) | - | 1185951..1187246 (+) | 1296 | WP_003695011.1 | DUF4043 family protein | - |
| KWY95_RS06300 (KWY95_06300) | - | 1187301..1187774 (+) | 474 | WP_003687996.1 | hypothetical protein | - |
| KWY95_RS06305 (KWY95_06305) | - | 1187780..1188265 (+) | 486 | WP_003701194.1 | hypothetical protein | - |
| KWY95_RS06310 (KWY95_06310) | - | 1188262..1188537 (+) | 276 | WP_010358526.1 | hypothetical protein | - |
| KWY95_RS06315 (KWY95_06315) | - | 1188528..1188935 (+) | 408 | WP_010358525.1 | hypothetical protein | - |
| KWY95_RS06320 (KWY95_06320) | - | 1188938..1189087 (+) | 150 | WP_003706419.1 | hypothetical protein | - |
| KWY95_RS06325 (KWY95_06325) | - | 1189124..1189969 (-) | 846 | WP_003701197.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17520.23 Da Isoelectric Point: 9.1635
>NTDB_id=587038 KWY95_RS06045 WP_025456240.1 1150916..1151389(+) (pilL) [Neisseria gonorrhoeae strain SK92679]
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDTLKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDAASAWVYSDTLSADSGCEAFSNRKK
MEQKGFTLIEMMIVVTILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPQDDNDTLKSKLEIFVSGYKM
NPKIAKKYSVSVKFVDAEKPRAYRLVGVPNAGTGYTLSVWMNSVGDGYKCRDAASAWVYSDTLSADSGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=587038 KWY95_RS06045 WP_025456240.1 1150916..1151389(+) (pilL) [Neisseria gonorrhoeae strain SK92679]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATACCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACTCTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCTGGGTCTATTCGGACACCTTGTCCGCAGATAGCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCACGATACTCGGCATCATCAGCGTCATTGCCATACC
TTCTTATCAGAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCAGGACGATAATGATACCCTCAAGAGCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTAAAGTTTGTCGATGCGGAAAAACCAAGGGCATACAGGTTGGTCGG
TGTTCCGAACGCGGGGACGGGTTATACTCTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCTGGGTCTATTCGGACACCTTGTCCGCAGATAGCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
94.268 |
100 |
0.943 |
| pilX | Neisseria meningitidis 8013 |
85.987 |
100 |
0.86 |