Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilK   Type   Machinery gene
Locus tag   KWY95_RS06040 Genome accession   NZ_CP078117
Coordinates   1150303..1150914 (+) Length   203 a.a.
NCBI ID   WP_003701063.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain SK92679     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1151459..1189969 1150303..1150914 flank 545


Gene organization within MGE regions


Location: 1150303..1189969
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KWY95_RS06040 (KWY95_06040) pilK 1150303..1150914 (+) 612 WP_003701063.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  KWY95_RS06045 (KWY95_06045) pilL 1150916..1151389 (+) 474 WP_025456240.1 PilX family type IV pilin Machinery gene
  KWY95_RS06050 (KWY95_06050) - 1151459..1151767 (-) 309 WP_025456241.1 AzlD family protein -
  KWY95_RS06055 (KWY95_06055) - 1151764..1152475 (-) 712 Protein_1163 AzlC family ABC transporter permease -
  KWY95_RS06060 (KWY95_06060) dut 1152641..1153093 (+) 453 WP_003701071.1 dUTP diphosphatase -
  KWY95_RS06065 (KWY95_06065) dapC 1153165..1154352 (+) 1188 WP_003701073.1 succinyldiaminopimelate transaminase -
  KWY95_RS06070 (KWY95_06070) yaaA 1154508..1155287 (+) 780 WP_003687925.1 peroxide stress protein YaaA -
  KWY95_RS06085 (KWY95_06085) - 1155817..1157017 (+) 1201 Protein_1167 tyrosine-type recombinase/integrase -
  KWY95_RS06095 (KWY95_06095) - 1157373..1157642 (-) 270 WP_003687928.1 hypothetical protein -
  KWY95_RS06100 (KWY95_06100) - 1157837..1158520 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  KWY95_RS11900 - 1158834..1159067 (-) 234 Protein_1170 hypothetical protein -
  KWY95_RS06110 (KWY95_06110) - 1159178..1159393 (-) 216 WP_003691538.1 hypothetical protein -
  KWY95_RS06115 (KWY95_06115) - 1159445..1159936 (-) 492 WP_017147227.1 siphovirus Gp157 family protein -
  KWY95_RS06120 (KWY95_06120) - 1159933..1160115 (-) 183 WP_003691535.1 hypothetical protein -
  KWY95_RS06125 (KWY95_06125) - 1160255..1160941 (-) 687 WP_010359969.1 phage replication initiation protein, NGO0469 family -
  KWY95_RS06130 (KWY95_06130) - 1161010..1161171 (-) 162 WP_003691530.1 hypothetical protein -
  KWY95_RS06135 (KWY95_06135) - 1161168..1161443 (-) 276 WP_050154389.1 NGO1622 family putative holin -
  KWY95_RS06140 (KWY95_06140) - 1161596..1161928 (-) 333 WP_003696914.1 hypothetical protein -
  KWY95_RS06145 (KWY95_06145) - 1162069..1162344 (-) 276 WP_218423491.1 hypothetical protein -
  KWY95_RS06150 (KWY95_06150) - 1162341..1162817 (-) 477 WP_003691526.1 hypothetical protein -
  KWY95_RS06155 (KWY95_06155) - 1162850..1163050 (-) 201 WP_003704298.1 hypothetical protein -
  KWY95_RS06160 (KWY95_06160) - 1163248..1163661 (-) 414 WP_003687963.1 hypothetical protein -
  KWY95_RS06165 (KWY95_06165) - 1163658..1164119 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  KWY95_RS06170 (KWY95_06170) - 1164136..1164573 (-) 438 WP_003687967.1 hypothetical protein -
  KWY95_RS06175 (KWY95_06175) - 1164686..1165402 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  KWY95_RS06180 (KWY95_06180) - 1165471..1165707 (+) 237 WP_003687971.1 Cro/CI family transcriptional regulator -
  KWY95_RS06185 (KWY95_06185) - 1165787..1165942 (+) 156 WP_003698902.1 hypothetical protein -
  KWY95_RS06190 (KWY95_06190) - 1165919..1166107 (-) 189 WP_050157615.1 hypothetical protein -
  KWY95_RS06195 (KWY95_06195) - 1166280..1166507 (+) 228 WP_050158909.1 helix-turn-helix domain-containing protein -
  KWY95_RS06200 (KWY95_06200) - 1166504..1166641 (+) 138 WP_170309797.1 hypothetical protein -
  KWY95_RS11505 - 1167186..1167689 (+) 504 WP_010360005.1 hypothetical protein -
  KWY95_RS06210 (KWY95_06210) - 1167686..1169047 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  KWY95_RS06215 (KWY95_06215) - 1169084..1169347 (+) 264 WP_154230797.1 hypothetical protein -
  KWY95_RS06220 (KWY95_06220) - 1169386..1169880 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  KWY95_RS06225 (KWY95_06225) - 1170057..1170206 (+) 150 WP_003692854.1 hypothetical protein -
  KWY95_RS11510 - 1170235..1170516 (+) 282 WP_003689109.1 hypothetical protein -
  KWY95_RS06230 (KWY95_06230) - 1170507..1170944 (+) 438 WP_232038206.1 RusA family crossover junction endodeoxyribonuclease -
  KWY95_RS06235 (KWY95_06235) - 1170937..1171242 (+) 306 WP_003687981.1 nuclease domain-containing protein -
  KWY95_RS06240 (KWY95_06240) - 1171239..1171622 (+) 384 WP_003690918.1 recombination protein NinB -
  KWY95_RS06245 (KWY95_06245) - 1171613..1172131 (+) 519 WP_003687984.1 HNH endonuclease -
  KWY95_RS06250 (KWY95_06250) - 1172196..1172618 (+) 423 WP_003690919.1 hypothetical protein -
  KWY95_RS11515 - 1172618..1173157 (+) 540 WP_003690920.1 hypothetical protein -
  KWY95_RS06265 (KWY95_06265) - 1173138..1174412 (+) 1275 WP_003701186.1 PBSX family phage terminase large subunit -
  KWY95_RS06270 (KWY95_06270) - 1174397..1176664 (+) 2268 WP_225577699.1 hypothetical protein -
  KWY95_RS06275 (KWY95_06275) - 1176901..1178097 (+) 1197 WP_003690925.1 hypothetical protein -
  KWY95_RS06280 (KWY95_06280) - 1178094..1178561 (+) 468 WP_003701187.1 hypothetical protein -
  KWY95_RS06285 (KWY95_06285) - 1178548..1179120 (+) 573 WP_169301118.1 hypothetical protein -
  KWY95_RS11520 - 1182107..1185211 (+) 3105 Protein_1207 PLxRFG domain-containing protein -
  KWY95_RS11525 - 1185193..1185930 (+) 738 WP_003701191.1 hypothetical protein -
  KWY95_RS06295 (KWY95_06295) - 1185951..1187246 (+) 1296 WP_003695011.1 DUF4043 family protein -
  KWY95_RS06300 (KWY95_06300) - 1187301..1187774 (+) 474 WP_003687996.1 hypothetical protein -
  KWY95_RS06305 (KWY95_06305) - 1187780..1188265 (+) 486 WP_003701194.1 hypothetical protein -
  KWY95_RS06310 (KWY95_06310) - 1188262..1188537 (+) 276 WP_010358526.1 hypothetical protein -
  KWY95_RS06315 (KWY95_06315) - 1188528..1188935 (+) 408 WP_010358525.1 hypothetical protein -
  KWY95_RS06320 (KWY95_06320) - 1188938..1189087 (+) 150 WP_003706419.1 hypothetical protein -
  KWY95_RS06325 (KWY95_06325) - 1189124..1189969 (-) 846 WP_003701197.1 Bro-N domain-containing protein -

Sequence


Protein


Download         Length: 203 a.a.        Molecular weight: 22098.86 Da        Isoelectric Point: 5.3780

>NTDB_id=587037 KWY95_RS06040 WP_003701063.1 1150303..1150914(+) (pilK) [Neisseria gonorrhoeae strain SK92679]
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCEKGLCTAVNVRTNNNGNEEAFGNIVVQGTPTVEAVKRSCPAKSGKSSTGLCIDNQGVEYEKGTGNVSKMP
RYIIEYLGEKNNQNIYRVTAKAWGKNANTVVVLQSYVGNNDEQ

Nucleotide


Download         Length: 612 bp        

>NTDB_id=587037 KWY95_RS06040 WP_003701063.1 1150303..1150914(+) (pilK) [Neisseria gonorrhoeae strain SK92679]
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGCCTGTGTACCGCAGTGAATGTGCGGACAAATAATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGCAAGGCACGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAGTTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATGAGAAAGGTACGGGAAACGTCAGCAAAATGCCG
CGTTATATTATCGAATATTTGGGCGAGAAGAATAACCAAAATATTTACAGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTGCAATCTTATGTAGGCAATAATGATGAGCAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilK Neisseria gonorrhoeae MS11

99.015

100

0.99