Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   KU514_RS03585 Genome accession   NZ_CP077919
Coordinates   693654..694124 (-) Length   156 a.a.
NCBI ID   WP_209025515.1    Uniprot ID   -
Organism   Staphylococcus aureus strain 278     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 655241..709888 693654..694124 within 0


Gene organization within MGE regions


Location: 655241..709888
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KU514_RS03345 (KU514_03315) pknB 655241..657235 (-) 1995 WP_000579564.1 serine/threonine protein kinase Stk1 -
  KU514_RS03350 (KU514_03320) - 657232..657975 (-) 744 WP_000888497.1 protein-serine/threonine phosphatase Stp1 -
  KU514_RS03355 (KU514_03325) rlmN 657982..659076 (-) 1095 WP_000626900.1 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN -
  KU514_RS03360 (KU514_03330) rsmB 659079..660386 (-) 1308 WP_000572235.1 16S rRNA (cytosine(967)-C(5))-methyltransferase RsmB -
  KU514_RS03365 (KU514_03335) fmt 660383..661318 (-) 936 WP_225806609.1 methionyl-tRNA formyltransferase -
  KU514_RS03370 (KU514_03340) - 661311..661799 (-) 489 WP_000985289.1 peptide deformylase -
  KU514_RS03375 (KU514_03345) - 662098..662301 (+) 204 WP_001198024.1 TM2 domain-containing protein -
  KU514_RS03380 (KU514_03350) - 662439..663410 (-) 972 WP_000751709.1 hypothetical protein -
  KU514_RS03385 (KU514_03355) - 664257..664439 (-) 183 Protein_611 DNA-binding protein -
  KU514_RS03390 (KU514_03360) - 664825..666279 (-) 1455 WP_225806610.1 N-acetylmuramoyl-L-alanine amidase -
  KU514_RS03395 (KU514_03365) - 666290..666592 (-) 303 WP_031872328.1 phage holin -
  KU514_RS03400 (KU514_03370) - 666719..667093 (-) 375 WP_031879796.1 hypothetical protein -
  KU514_RS03405 (KU514_03375) - 667149..667436 (-) 288 WP_031763773.1 hypothetical protein -
  KU514_RS03410 (KU514_03380) - 667482..667634 (-) 153 WP_047447729.1 hypothetical protein -
  KU514_RS03415 (KU514_03385) - 667627..672234 (-) 4608 WP_209025494.1 phage tail spike protein -
  KU514_RS03420 (KU514_03390) - 672250..673734 (-) 1485 WP_209025495.1 phage tail domain-containing protein -
  KU514_RS03425 (KU514_03395) - 673734..678260 (-) 4527 WP_209025496.1 phage tail tape measure protein -
  KU514_RS03430 - 678317..678454 (-) 138 WP_001549167.1 hypothetical protein -
  KU514_RS03435 (KU514_03400) - 678505..678855 (-) 351 WP_031906184.1 hypothetical protein -
  KU514_RS03440 (KU514_03405) - 678905..679144 (-) 240 WP_150530609.1 Ig-like domain-containing protein -
  KU514_RS03445 (KU514_03410) - 679171..679815 (-) 645 WP_033859824.1 major tail protein -
  KU514_RS03450 (KU514_03415) - 679819..680223 (-) 405 WP_000565500.1 hypothetical protein -
  KU514_RS03455 (KU514_03420) - 680220..680624 (-) 405 WP_209025497.1 HK97 gp10 family phage protein -
  KU514_RS03460 (KU514_03425) - 680621..680983 (-) 363 WP_031872356.1 head-tail adaptor protein -
  KU514_RS03465 (KU514_03430) - 680967..681248 (-) 282 WP_209025498.1 phage head-tail adapter protein -
  KU514_RS03470 (KU514_03435) - 681257..681535 (-) 279 WP_209025499.1 hypothetical protein -
  KU514_RS03475 (KU514_03440) - 681554..682693 (-) 1140 WP_225806611.1 phage major capsid protein -
  KU514_RS03480 (KU514_03445) - 682717..683439 (-) 723 WP_000700968.1 head maturation protease, ClpP-related -
  KU514_RS03485 (KU514_03450) - 683436..684584 (-) 1149 WP_000511812.1 phage portal protein -
  KU514_RS03490 (KU514_03455) - 684599..686260 (-) 1662 WP_209025501.1 terminase large subunit -
  KU514_RS03495 (KU514_03460) - 686257..686601 (-) 345 WP_000402904.1 hypothetical protein -
  KU514_RS03500 (KU514_03465) - 686731..687030 (-) 300 WP_209025502.1 HNH endonuclease -
  KU514_RS03505 (KU514_03470) - 687262..687678 (-) 417 WP_000590126.1 hypothetical protein -
  KU514_RS03510 (KU514_03475) - 687706..687906 (-) 201 WP_209025529.1 DUF1514 family protein -
  KU514_RS03515 (KU514_03480) - 687906..688055 (-) 150 WP_209025503.1 transcriptional regulator -
  KU514_RS13805 (KU514_03485) - 688084..688143 (-) 60 Protein_638 DUF1381 domain-containing protein -
  KU514_RS03520 (KU514_03490) - 688322..688495 (-) 174 WP_001209217.1 hypothetical protein -
  KU514_RS03525 (KU514_03495) - 688532..689062 (-) 531 WP_225806612.1 dUTPase -
  KU514_RS03530 - 689418..689543 (-) 126 Protein_641 DUF1024 family protein -
  KU514_RS03535 (KU514_03505) - 689536..689946 (-) 411 WP_209025506.1 acetyltransferase -
  KU514_RS03540 (KU514_03510) - 689943..690452 (-) 510 WP_209025507.1 hypothetical protein -
  KU514_RS03545 (KU514_03515) - 690449..690886 (-) 438 WP_209025508.1 YopX family protein -
  KU514_RS03550 (KU514_03520) - 690883..691077 (-) 195 WP_209025509.1 hypothetical protein -
  KU514_RS03555 (KU514_03525) - 691074..691460 (-) 387 WP_209025510.1 hypothetical protein -
  KU514_RS03560 (KU514_03530) - 691475..691717 (-) 243 WP_209025511.1 SAV1978 family virulence-associated passenger protein -
  KU514_RS03565 (KU514_03535) - 691721..692089 (-) 369 WP_031887145.1 SA1788 family PVL leukocidin-associated protein -
  KU514_RS03570 (KU514_03540) - 692102..692506 (-) 405 WP_209025512.1 RusA family crossover junction endodeoxyribonuclease -
  KU514_RS03575 (KU514_03545) - 692515..692733 (-) 219 WP_209025513.1 hypothetical protein -
  KU514_RS03580 (KU514_03550) - 692740..693624 (-) 885 WP_209025514.1 DnaD domain protein -
  KU514_RS03585 (KU514_03555) ssbA 693654..694124 (-) 471 WP_209025515.1 single-stranded DNA-binding protein Machinery gene
  KU514_RS03590 (KU514_03560) - 694125..694742 (-) 618 WP_077517322.1 MBL fold metallo-hydrolase -
  KU514_RS03595 (KU514_03565) - 694823..695743 (-) 921 WP_053007322.1 recombinase RecT -
  KU514_RS03600 (KU514_03570) - 695745..697688 (-) 1944 WP_225806613.1 AAA family ATPase -
  KU514_RS03605 (KU514_03575) - 697697..697960 (-) 264 WP_001205732.1 hypothetical protein -
  KU514_RS03610 (KU514_03580) - 697969..698229 (-) 261 WP_209025518.1 DUF1108 family protein -
  KU514_RS03615 (KU514_03585) - 698210..698536 (-) 327 WP_209025519.1 DUF2482 family protein -
  KU514_RS03620 (KU514_03590) - 698632..698793 (-) 162 WP_209025520.1 DUF1270 family protein -
  KU514_RS03625 (KU514_03595) - 698806..699069 (-) 264 WP_115207353.1 helix-turn-helix domain-containing protein -
  KU514_RS03630 (KU514_03600) - 699084..699839 (-) 756 WP_209025521.1 phage regulatory protein/antirepressor Ant -
  KU514_RS03635 (KU514_03605) - 699896..700276 (+) 381 WP_209025522.1 DUF2513 domain-containing protein -
  KU514_RS03640 (KU514_03610) - 700263..700460 (-) 198 WP_001148855.1 hypothetical protein -
  KU514_RS03645 (KU514_03615) - 700476..701225 (-) 750 WP_001148337.1 phage antirepressor KilAC domain-containing protein -
  KU514_RS03650 (KU514_03620) - 701282..701821 (+) 540 WP_000351243.1 hypothetical protein -
  KU514_RS03655 (KU514_03625) - 701845..702105 (-) 261 WP_000435341.1 transcriptional regulator -
  KU514_RS03660 (KU514_03630) - 702123..702347 (-) 225 WP_000338186.1 DUF739 family protein -
  KU514_RS03665 (KU514_03635) - 702506..703276 (+) 771 WP_001208482.1 S24 family peptidase -
  KU514_RS03670 (KU514_03640) - 703476..703658 (+) 183 WP_000705243.1 hypothetical protein -
  KU514_RS03675 - 703803..704153 (-) 351 WP_225806614.1 hypothetical protein -
  KU514_RS03680 (KU514_03650) - 704550..705755 (+) 1206 WP_209025527.1 site-specific integrase -
  KU514_RS03685 (KU514_03655) priA 705847..708255 (-) 2409 WP_000560858.1 primosomal protein N' -
  KU514_RS03690 (KU514_03660) coaBC 708255..709454 (-) 1200 WP_000722165.1 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC -
  KU514_RS03695 (KU514_03665) rpoZ 709670..709888 (-) 219 WP_000933956.1 DNA-directed RNA polymerase subunit omega -

Sequence

Protein


Download         Length: 156 a.a.        Molecular weight: 17627.49 Da        Isoelectric Point: 5.2672

>NTDB_id=585080 KU514_RS03585 WP_209025515.1 693654..694124(-) (ssbA) [Staphylococcus aureus strain 278]
MINRTILVGRLTRDPELRTTQSGVNVASFTLAVNRTFTNAQGEREADFINVIVFKKQAENVNKYLSKGSLAGVDGRLQTR
NYENKEGQRVYVTEVIADSIQFLEPKNSNDTQQDLYQQQVQQTRGQSQYSNNKPVKDNPFANANGPIELNDDDLPF

Nucleotide


Download         Length: 471 bp        

>NTDB_id=585080 KU514_RS03585 WP_209025515.1 693654..694124(-) (ssbA) [Staphylococcus aureus strain 278]
ATGATAAACAGAACAATATTAGTTGGTCGTTTAACTAGAGACCCAGAATTAAGGACCACTCAAAGTGGTGTAAATGTAGC
ATCATTCACATTAGCAGTTAACCGCACATTTACGAATGCACAAGGCGAGCGCGAGGCAGATTTTATTAATGTCATTGTAT
TTAAAAAACAAGCAGAGAATGTAAATAAATACCTATCTAAAGGATCATTGGCGGGCGTAGATGGCAGATTACAAACGCGT
AACTATGAAAATAAGGAAGGTCAACGTGTATATGTTACGGAAGTTATTGCTGATAGTATTCAATTTTTAGAACCGAAAAA
CTCAAATGATACTCAACAAGATTTATATCAACAACAAGTACAACAAACACGTGGGCAATCGCAATATTCAAATAACAAAC
CAGTAAAAGATAATCCGTTTGCTAATGCAAATGGTCCGATTGAACTAAATGACGATGATTTACCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

55.367

100

0.628
  ssb Latilactobacillus sakei subsp. sakei 23K

51.176

100

0.558
  ssbB Bacillus subtilis subsp. subtilis str. 168

59.434

67.949

0.404
  ssb Vibrio cholerae strain A1552

31.492

100

0.365
  ssb Glaesserella parasuis strain SC1401

32.203

100

0.365