Detailed information NTG0058358

Bioinformatically predicted

Overview

• Name: comA
• Type: Regulator
• Locus tag: EP179_RS00845
• Genome accession: NZ_AP018381
• Coordinates: 138067..138348 (+)
• Length: 93 a.a.
• NCBI ID: WP_003696701.1
• Uniprot ID: A0A0H4IVZ5
• Organism: Neisseria gonorrhoeae strain FC460
• Function: processing and transport of ComC (predicted from homology) Competence regulation

Genomic Context

Location: 133067..143348

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
EP179_RS00810 (NgFC460_00115)	-	133173..134327 (+)	1155	WP_010359759.1	cupin domain-containing protein	-
EP179_RS00815	-	134336..134562 (+)	227	Protein_118	hypothetical protein	-
EP179_RS00820	-	134637..134909 (+)	273	WP_226888059.1	hypothetical protein	-
EP179_RS00825 (NgFC460_00118)	-	134970..136244 (+)	1275	WP_003698048.1	HlyD family secretion protein	-
EP179_RS00830 (NgFC460_00119)	-	136429..136776 (+)	348	WP_003687399.1	hypothetical protein	-
EP179_RS00835 (NgFC460_00120)	-	136790..137005 (+)	216	WP_003687400.1	hypothetical protein	-
EP179_RS00840 (NgFC460_00121)	-	137107..137658 (+)	552	Protein_123	cysteine peptidase family C39 domain-containing protein	-
EP179_RS14455	-	137644..137874 (+)	231	WP_225577429.1	ATP-binding cassette domain-containing protein	-
EP179_RS13500	-	137872..137988 (-)	117	Protein_125	IS5/IS1182 family transposase	-
EP179_RS00845 (NgFC460_00122)	comA	138067..138348 (+)	282	WP_003696701.1	ATP-binding cassette domain-containing protein	Regulator
EP179_RS00850 (NgFC460_00123)	-	138369..139595 (-)	1227	WP_003690589.1	YihY family inner membrane protein	-
EP179_RS13955 (NgFC460_00124)	-	139694..139880 (+)	187	Protein_128	NAD(P)H-quinone oxidoreductase	-
EP179_RS00855 (NgFC460_00125)	queC	140084..140743 (+)	660	WP_003690590.1	7-cyano-7-deazaguanine synthase QueC	-
EP179_RS00860 (NgFC460_00126)	-	140771..141286 (+)	516	WP_003687408.1	DUF1543 domain-containing protein	-
EP179_RS00865 (NgFC460_00127)	queD	141374..141808 (+)	435	WP_003690591.1	6-carboxytetrahydropterin synthase QueD	-
EP179_RS00875 (NgFC460_00128)	-	142079..142447 (+)	369	WP_003690592.1	DUF1304 domain-containing protein	-
EP179_RS00880 (NgFC460_00129)	-	142444..143082 (+)	639	WP_103195245.1	7-carboxy-7-deazaguanine synthase QueE	-

Sequence

Protein

• Length: 93 a.a.
• Molecular weight: 10117.78 Da
• Isoelectric Point: 6.4598

>NTDB_id=58358 EP179_RS00845 WP_003696701.1 138067..138348(+) (comA) [Neisseria gonorrhoeae strain FC460]
MIREEISAMPMGYETLIGDMGSALSGGQKQRIVLARALYCEPKILFLDEAASHLDIANEKAVNANLNGLSIIKIMAAHRK
ETVESADRKMSLG

Nucleotide

• Length: 282 bp

>NTDB_id=58358 EP179_RS00845 WP_003696701.1 138067..138348(+) (comA) [Neisseria gonorrhoeae strain FC460]
ATGATTCGCGAAGAAATCTCCGCCATGCCTATGGGCTATGAAACCTTGATCGGCGATATGGGCAGCGCACTGTCAGGCGG
ACAAAAACAACGTATCGTATTGGCGCGGGCCTTATATTGCGAACCGAAAATCCTATTTTTAGATGAAGCGGCCAGTCATT
TGGATATTGCCAATGAAAAAGCAGTCAATGCAAACTTGAATGGCTTGTCTATTATAAAAATTATGGCGGCACACAGAAAG
GAAACGGTGGAATCAGCAGATAGGAAAATGTCTTTAGGATAA

Domains

Predicted by InterProScan.

• ABC transporter (ABC_tran) (14-51)

3D structure

• AlphaFold DB: A0A0H4IVZ5

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comA	Streptococcus mitis SK321	46.154	97.849	0.452
comA	Streptococcus mitis NCTC 12261	45.055	97.849	0.441
comA	Streptococcus pneumoniae TIGR4	45.055	97.849	0.441
comA	Streptococcus pneumoniae Rx1	45.055	97.849	0.441
comA	Streptococcus pneumoniae R6	45.055	97.849	0.441
comA	Streptococcus pneumoniae D39	45.055	97.849	0.441
comA/nlmT	Streptococcus mutans UA159	47.126	93.548	0.441
comA	Streptococcus gordonii str. Challis substr. CH1	43.956	97.849	0.43