Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | KP005_RS18495 | Genome accession | NZ_CP076724 |
| Coordinates | 4189454..4189894 (+) | Length | 146 a.a. |
| NCBI ID | WP_216500083.1 | Uniprot ID | - |
| Organism | Geomonas nitrogeniifigens strain RG29 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Genomic island | 4156734..4188508 | 4189454..4189894 | flank | 946 |
Gene organization within MGE regions
Location: 4156734..4189894
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KP005_RS18320 (KP005_18320) | - | 4156734..4157615 (+) | 882 | WP_216789669.1 | ATP-binding protein | - |
| KP005_RS18325 (KP005_18325) | - | 4157632..4158189 (+) | 558 | WP_216789673.1 | hypothetical protein | - |
| KP005_RS18330 (KP005_18330) | - | 4158266..4158514 (+) | 249 | WP_216789674.1 | WYL domain-containing protein | - |
| KP005_RS18335 (KP005_18335) | - | 4158608..4158847 (+) | 240 | WP_216789676.1 | multiubiquitin domain-containing protein | - |
| KP005_RS18340 (KP005_18340) | - | 4158847..4159254 (+) | 408 | WP_216789678.1 | E2/UBC family protein | - |
| KP005_RS18345 (KP005_18345) | - | 4159251..4160708 (+) | 1458 | WP_216789679.1 | ThiF family adenylyltransferase | - |
| KP005_RS21210 | - | 4160695..4161117 (+) | 423 | WP_367620813.1 | DUF6527 family protein | - |
| KP005_RS20950 | - | 4161596..4161739 (+) | 144 | WP_239031659.1 | ATP-binding protein | - |
| KP005_RS18355 (KP005_18355) | - | 4161789..4163387 (-) | 1599 | WP_216789681.1 | TnsD family Tn7-like transposition protein | - |
| KP005_RS18360 (KP005_18360) | - | 4163380..4164756 (-) | 1377 | WP_216789682.1 | ATP-binding protein | - |
| KP005_RS18365 (KP005_18365) | - | 4164756..4166897 (-) | 2142 | WP_216789683.1 | transposase family protein | - |
| KP005_RS18370 (KP005_18370) | - | 4166914..4167708 (-) | 795 | WP_216789684.1 | TnsA endonuclease N-terminal domain-containing protein | - |
| KP005_RS18375 (KP005_18375) | - | 4167964..4168572 (-) | 609 | WP_216789685.1 | hypothetical protein | - |
| KP005_RS18380 (KP005_18380) | - | 4168900..4169841 (+) | 942 | WP_216789686.1 | hypothetical protein | - |
| KP005_RS18385 (KP005_18385) | - | 4170078..4170266 (+) | 189 | WP_216789688.1 | hypothetical protein | - |
| KP005_RS18390 (KP005_18390) | - | 4170838..4171131 (-) | 294 | WP_216789690.1 | hypothetical protein | - |
| KP005_RS21215 | - | 4171368..4171508 (-) | 141 | Protein_3618 | aldo/keto reductase | - |
| KP005_RS18395 (KP005_18395) | - | 4171727..4172074 (-) | 348 | WP_216789692.1 | hypothetical protein | - |
| KP005_RS18400 (KP005_18400) | - | 4172932..4173576 (+) | 645 | WP_275423298.1 | tyrosine-type recombinase/integrase | - |
| KP005_RS18405 (KP005_18405) | - | 4173605..4174810 (-) | 1206 | WP_216789694.1 | type II toxin-antitoxin system HipA family toxin | - |
| KP005_RS18410 (KP005_18410) | - | 4174807..4175046 (-) | 240 | WP_216789696.1 | helix-turn-helix domain-containing protein | - |
| KP005_RS18415 (KP005_18415) | - | 4175245..4175826 (+) | 582 | WP_216789698.1 | TetR/AcrR family transcriptional regulator | - |
| KP005_RS18420 (KP005_18420) | - | 4176096..4176548 (+) | 453 | WP_216789700.1 | CGGC domain-containing protein | - |
| KP005_RS18425 (KP005_18425) | - | 4176676..4177710 (+) | 1035 | WP_216789701.1 | NADH:flavin oxidoreductase | - |
| KP005_RS18430 (KP005_18430) | - | 4177887..4178870 (+) | 984 | WP_275423299.1 | MBL fold metallo-hydrolase | - |
| KP005_RS18435 (KP005_18435) | - | 4178879..4179772 (+) | 894 | WP_216789705.1 | alpha/beta hydrolase | - |
| KP005_RS18440 (KP005_18440) | - | 4179821..4180231 (+) | 411 | WP_216789707.1 | hypothetical protein | - |
| KP005_RS18445 (KP005_18445) | - | 4180500..4181120 (+) | 621 | WP_216789708.1 | flavin reductase family protein | - |
| KP005_RS18450 (KP005_18450) | - | 4181278..4182174 (+) | 897 | WP_216789710.1 | alpha/beta hydrolase | - |
| KP005_RS18455 (KP005_18455) | - | 4182205..4182993 (+) | 789 | WP_216789712.1 | enoyl-CoA hydratase/isomerase family protein | - |
| KP005_RS21220 | - | 4183031..4183177 (+) | 147 | Protein_3632 | alpha/beta hydrolase | - |
| KP005_RS18460 (KP005_18460) | - | 4183226..4183474 (+) | 249 | WP_216789714.1 | hypothetical protein | - |
| KP005_RS18465 (KP005_18465) | - | 4183471..4183995 (+) | 525 | WP_216789715.1 | hypothetical protein | - |
| KP005_RS18470 (KP005_18470) | - | 4184050..4184463 (+) | 414 | WP_216789717.1 | tautomerase family protein | - |
| KP005_RS20955 | - | 4184479..4184604 (+) | 126 | Protein_3636 | ISAs1 family transposase | - |
| KP005_RS18475 (KP005_18475) | - | 4185339..4186226 (+) | 888 | WP_216789719.1 | MBL fold metallo-hydrolase | - |
| KP005_RS18480 (KP005_18480) | - | 4186385..4186972 (-) | 588 | WP_216789720.1 | TetR/AcrR family transcriptional regulator | - |
| KP005_RS18485 (KP005_18485) | - | 4187172..4187564 (-) | 393 | WP_216792024.1 | helix-turn-helix domain-containing protein | - |
| KP005_RS18490 (KP005_18490) | - | 4187660..4188508 (+) | 849 | WP_216789722.1 | SDR family oxidoreductase | - |
| KP005_RS18495 (KP005_18495) | ssb | 4189454..4189894 (+) | 441 | WP_216500083.1 | single-stranded DNA-binding protein | Machinery gene |
Sequence
Protein
Download Length: 146 a.a. Molecular weight: 16191.04 Da Isoelectric Point: 5.3193
>NTDB_id=577637 KP005_RS18495 WP_216500083.1 4189454..4189894(+) (ssb) [Geomonas nitrogeniifigens strain RG29]
MASLNKVMLIGNLGKDPEVRYTAGGTAVASFSLATTDRIKGKDGNWEDKTEWHNITLWARLAEIAGEYLSKGKTVYIEGR
LQTRKWTDKDGKDRYTTEIVGEKMQMLSAKGEGGGQRQGGGRPQQDYNQGGGYEEPVFNPDDEIPF
MASLNKVMLIGNLGKDPEVRYTAGGTAVASFSLATTDRIKGKDGNWEDKTEWHNITLWARLAEIAGEYLSKGKTVYIEGR
LQTRKWTDKDGKDRYTTEIVGEKMQMLSAKGEGGGQRQGGGRPQQDYNQGGGYEEPVFNPDDEIPF
Nucleotide
Download Length: 441 bp
>NTDB_id=577637 KP005_RS18495 WP_216500083.1 4189454..4189894(+) (ssb) [Geomonas nitrogeniifigens strain RG29]
ATGGCAAGTCTCAACAAGGTGATGCTCATAGGCAACCTGGGCAAAGACCCCGAGGTGCGCTACACCGCCGGCGGTACCGC
CGTAGCTTCCTTCTCCCTGGCCACCACCGACCGGATCAAGGGCAAGGACGGCAACTGGGAAGACAAGACCGAATGGCACA
ACATCACCCTCTGGGCGCGTCTTGCCGAGATCGCCGGCGAGTACCTCTCCAAGGGGAAGACCGTATATATCGAGGGACGT
CTGCAGACCCGCAAGTGGACCGACAAGGACGGCAAGGACCGCTACACCACCGAGATCGTAGGTGAGAAGATGCAGATGCT
CTCCGCCAAGGGTGAAGGCGGCGGCCAGCGCCAGGGTGGCGGCAGGCCCCAGCAGGACTACAACCAGGGGGGCGGTTACG
AGGAGCCGGTCTTCAACCCGGACGACGAGATCCCGTTCTAG
ATGGCAAGTCTCAACAAGGTGATGCTCATAGGCAACCTGGGCAAAGACCCCGAGGTGCGCTACACCGCCGGCGGTACCGC
CGTAGCTTCCTTCTCCCTGGCCACCACCGACCGGATCAAGGGCAAGGACGGCAACTGGGAAGACAAGACCGAATGGCACA
ACATCACCCTCTGGGCGCGTCTTGCCGAGATCGCCGGCGAGTACCTCTCCAAGGGGAAGACCGTATATATCGAGGGACGT
CTGCAGACCCGCAAGTGGACCGACAAGGACGGCAAGGACCGCTACACCACCGAGATCGTAGGTGAGAAGATGCAGATGCT
CTCCGCCAAGGGTGAAGGCGGCGGCCAGCGCCAGGGTGGCGGCAGGCCCCAGCAGGACTACAACCAGGGGGGCGGTTACG
AGGAGCCGGTCTTCAACCCGGACGACGAGATCCCGTTCTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Vibrio cholerae strain A1552 |
47.458 |
100 |
0.575 |
| ssb | Glaesserella parasuis strain SC1401 |
42.778 |
100 |
0.527 |
| ssb | Neisseria meningitidis MC58 |
49.231 |
89.041 |
0.438 |
| ssb | Neisseria gonorrhoeae MS11 |
53.097 |
77.397 |
0.411 |
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
32.37 |
100 |
0.384 |