Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   MPG52_RS00965 Genome accession   NZ_CP094157
Coordinates   206237..206350 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   Q9ZEL1
Organism   Helicobacter pylori strain Hpfe0021     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 201237..211350
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MPG52_RS00940 (MPG52_00940) - 201290..203515 (+) 2226 WP_245076827.1 ATP-dependent Clp protease ATP-binding subunit -
  MPG52_RS00945 (MPG52_00945) panD 203505..203858 (+) 354 WP_079357806.1 aspartate 1-decarboxylase -
  MPG52_RS00950 (MPG52_00950) - 203861..204163 (+) 303 WP_000347928.1 YbaB/EbfC family nucleoid-associated protein -
  MPG52_RS00955 (MPG52_00955) - 204163..205158 (+) 996 WP_245077217.1 PDZ domain-containing protein -
  MPG52_RS00960 (MPG52_00960) comB6 205166..206221 (+) 1056 WP_245077218.1 P-type conjugative transfer protein TrbL Machinery gene
  MPG52_RS00965 (MPG52_00965) comB7 206237..206350 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  MPG52_RS00970 (MPG52_00970) comB8 206347..207090 (+) 744 WP_180598095.1 virB8 family protein Machinery gene
  MPG52_RS00975 (MPG52_00975) comB9 207090..208073 (+) 984 WP_180598092.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  MPG52_RS00980 (MPG52_00980) comB10 208066..209196 (+) 1131 WP_245076829.1 DNA type IV secretion system protein ComB10 Machinery gene
  MPG52_RS00985 (MPG52_00985) - 209266..210678 (+) 1413 WP_245076831.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=576573 MPG52_RS00965 WP_001217873.1 206237..206350(+) (comB7) [Helicobacter pylori strain Hpfe0021]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=576573 MPG52_RS00965 WP_001217873.1 206237..206350(+) (comB7) [Helicobacter pylori strain Hpfe0021]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACATTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB Q9ZEL1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1