Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   KH238_RS10195 Genome accession   NZ_CP076045
Coordinates   2154059..2154496 (-) Length   145 a.a.
NCBI ID   WP_007408322.1    Uniprot ID   -
Organism   Bacillus velezensis strain VCN56     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2149059..2159496
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KH238_RS10145 (KH238_10145) sinI 2149450..2149623 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KH238_RS10150 (KH238_10150) sinR 2149657..2149992 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KH238_RS10155 (KH238_10155) - 2150040..2150825 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KH238_RS10160 (KH238_10160) - 2150890..2151474 (-) 585 WP_015240205.1 signal peptidase I SipW -
  KH238_RS10165 (KH238_10165) tapA 2151446..2152117 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  KH238_RS10170 (KH238_10170) - 2152376..2152705 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  KH238_RS10175 (KH238_10175) - 2152745..2152924 (-) 180 WP_003153093.1 YqzE family protein -
  KH238_RS10180 (KH238_10180) comGG 2152981..2153358 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  KH238_RS19570 comGF 2153359..2153526 (-) 168 WP_235183824.1 ComGF family competence protein Machinery gene
  KH238_RS19575 - 2153523..2153717 (-) 195 WP_225917419.1 hypothetical protein -
  KH238_RS10190 (KH238_10190) comGE 2153761..2154075 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  KH238_RS10195 (KH238_10195) comGD 2154059..2154496 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene
  KH238_RS10200 (KH238_10200) comGC 2154486..2154752 (-) 267 WP_042635730.1 competence type IV pilus major pilin ComGC Machinery gene
  KH238_RS10205 (KH238_10205) comGB 2154799..2155836 (-) 1038 WP_032866436.1 competence type IV pilus assembly protein ComGB Machinery gene
  KH238_RS10210 (KH238_10210) comGA 2155823..2156893 (-) 1071 WP_012117985.1 competence type IV pilus ATPase ComGA Machinery gene
  KH238_RS10215 (KH238_10215) - 2157085..2158035 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -
  KH238_RS10220 (KH238_10220) - 2158181..2159482 (+) 1302 WP_032866438.1 hemolysin family protein -

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16314.79 Da        Isoelectric Point: 10.2475

>NTDB_id=571614 KH238_RS10195 WP_007408322.1 2154059..2154496(-) (comGD) [Bacillus velezensis strain VCN56]
MNNNRRTENGFTLLESLIVLSLASVLLTVLFTTVPPVYTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIQLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=571614 KH238_RS10195 WP_007408322.1 2154059..2154496(-) (comGD) [Bacillus velezensis strain VCN56]
TTGAACAATAACAGGCGGACAGAAAATGGGTTTACCCTTCTTGAAAGCCTGATTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTACACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTCCAAAAAGATA
TTCAGCTTGCTCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGAAGGATTGTCGAGCGTTCCTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCAATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566