Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   KH238_RS10145 Genome accession   NZ_CP076045
Coordinates   2149450..2149623 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain VCN56     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2144450..2154623
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  KH238_RS10130 (KH238_10130) gcvT 2145263..2146363 (-) 1101 WP_032866432.1 glycine cleavage system aminomethyltransferase GcvT -
  KH238_RS10135 (KH238_10135) - 2146787..2148457 (+) 1671 WP_007408331.1 SNF2-related protein -
  KH238_RS10140 (KH238_10140) - 2148479..2149273 (+) 795 WP_007408330.1 YqhG family protein -
  KH238_RS10145 (KH238_10145) sinI 2149450..2149623 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  KH238_RS10150 (KH238_10150) sinR 2149657..2149992 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  KH238_RS10155 (KH238_10155) - 2150040..2150825 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  KH238_RS10160 (KH238_10160) - 2150890..2151474 (-) 585 WP_015240205.1 signal peptidase I SipW -
  KH238_RS10165 (KH238_10165) tapA 2151446..2152117 (-) 672 WP_020954230.1 amyloid fiber anchoring/assembly protein TapA -
  KH238_RS10170 (KH238_10170) - 2152376..2152705 (+) 330 WP_020954231.1 DUF3889 domain-containing protein -
  KH238_RS10175 (KH238_10175) - 2152745..2152924 (-) 180 WP_003153093.1 YqzE family protein -
  KH238_RS10180 (KH238_10180) comGG 2152981..2153358 (-) 378 WP_032866434.1 competence type IV pilus minor pilin ComGG Machinery gene
  KH238_RS19570 comGF 2153359..2153526 (-) 168 WP_235183824.1 ComGF family competence protein Machinery gene
  KH238_RS19575 - 2153523..2153717 (-) 195 WP_225917419.1 hypothetical protein -
  KH238_RS10190 (KH238_10190) comGE 2153761..2154075 (-) 315 WP_007408323.1 competence type IV pilus minor pilin ComGE -
  KH238_RS10195 (KH238_10195) comGD 2154059..2154496 (-) 438 WP_007408322.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=571611 KH238_RS10145 WP_003153105.1 2149450..2149623(+) (sinI) [Bacillus velezensis strain VCN56]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=571611 KH238_RS10145 WP_003153105.1 2149450..2149623(+) (sinI) [Bacillus velezensis strain VCN56]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702