Detailed information
Overview
| Name | comGF | Type | Machinery gene |
| Locus tag | KH238_RS19570 | Genome accession | NZ_CP076045 |
| Coordinates | 2153359..2153526 (-) | Length | 55 a.a. |
| NCBI ID | WP_235183824.1 | Uniprot ID | - |
| Organism | Bacillus velezensis strain VCN56 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Genomic Context
Location: 2148359..2158526
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KH238_RS10140 (KH238_10140) | - | 2148479..2149273 (+) | 795 | WP_007408330.1 | YqhG family protein | - |
| KH238_RS10145 (KH238_10145) | sinI | 2149450..2149623 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| KH238_RS10150 (KH238_10150) | sinR | 2149657..2149992 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| KH238_RS10155 (KH238_10155) | - | 2150040..2150825 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| KH238_RS10160 (KH238_10160) | - | 2150890..2151474 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| KH238_RS10165 (KH238_10165) | tapA | 2151446..2152117 (-) | 672 | WP_020954230.1 | amyloid fiber anchoring/assembly protein TapA | - |
| KH238_RS10170 (KH238_10170) | - | 2152376..2152705 (+) | 330 | WP_020954231.1 | DUF3889 domain-containing protein | - |
| KH238_RS10175 (KH238_10175) | - | 2152745..2152924 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| KH238_RS10180 (KH238_10180) | comGG | 2152981..2153358 (-) | 378 | WP_032866434.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| KH238_RS19570 | comGF | 2153359..2153526 (-) | 168 | WP_235183824.1 | ComGF family competence protein | Machinery gene |
| KH238_RS19575 | - | 2153523..2153717 (-) | 195 | WP_225917419.1 | hypothetical protein | - |
| KH238_RS10190 (KH238_10190) | comGE | 2153761..2154075 (-) | 315 | WP_007408323.1 | competence type IV pilus minor pilin ComGE | - |
| KH238_RS10195 (KH238_10195) | comGD | 2154059..2154496 (-) | 438 | WP_007408322.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| KH238_RS10200 (KH238_10200) | comGC | 2154486..2154752 (-) | 267 | WP_042635730.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| KH238_RS10205 (KH238_10205) | comGB | 2154799..2155836 (-) | 1038 | WP_032866436.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| KH238_RS10210 (KH238_10210) | comGA | 2155823..2156893 (-) | 1071 | WP_012117985.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| KH238_RS10215 (KH238_10215) | - | 2157085..2158035 (-) | 951 | WP_015417820.1 | magnesium transporter CorA family protein | - |
Sequence
Protein
Download Length: 55 a.a. Molecular weight: 5847.82 Da Isoelectric Point: 10.6868
>NTDB_id=571654 KH238_RS19570 WP_235183824.1 2153359..2153526(-) (comGF) [Bacillus velezensis strain VCN56]
MIRKRVNGKGHVPILQNAASLTADVKNGLLLLEISSVAGQKNQAVIPVYSSFKGD
MIRKRVNGKGHVPILQNAASLTADVKNGLLLLEISSVAGQKNQAVIPVYSSFKGD
Nucleotide
Download Length: 168 bp
>NTDB_id=571654 KH238_RS19570 WP_235183824.1 2153359..2153526(-) (comGF) [Bacillus velezensis strain VCN56]
ATGATAAGGAAAAGAGTAAACGGAAAAGGCCACGTGCCGATCCTGCAAAACGCGGCATCATTAACGGCTGATGTGAAAAA
CGGCCTGCTCTTATTAGAGATTTCAAGCGTTGCAGGTCAAAAGAATCAGGCGGTCATTCCGGTTTACAGCTCTTTTAAAG
GTGATTAA
ATGATAAGGAAAAGAGTAAACGGAAAAGGCCACGTGCCGATCCTGCAAAACGCGGCATCATTAACGGCTGATGTGAAAAA
CGGCCTGCTCTTATTAGAGATTTCAAGCGTTGCAGGTCAAAAGAATCAGGCGGTCATTCCGGTTTACAGCTCTTTTAAAG
GTGATTAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGF | Bacillus subtilis subsp. subtilis str. 168 |
51.852 |
98.182 |
0.509 |