Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   BAM5036_RS11415 Genome accession   NC_020410
Coordinates   2420523..2420900 (-) Length   125 a.a.
NCBI ID   WP_015417814.1    Uniprot ID   -
Organism   Bacillus velezensis UCMB5036     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2415523..2425900
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BAM5036_RS11375 (BAM5036_2213) - 2416021..2416815 (+) 795 WP_015417811.1 YqhG family protein -
  BAM5036_RS11380 (BAM5036_2214) sinI 2416992..2417165 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  BAM5036_RS11385 (BAM5036_2215) sinR 2417199..2417534 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  BAM5036_RS11390 (BAM5036_2216) tasA 2417582..2418367 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  BAM5036_RS11395 (BAM5036_2217) sipW 2418432..2419016 (-) 585 WP_015240205.1 signal peptidase I SipW -
  BAM5036_RS11400 (BAM5036_2218) tapA 2418988..2419659 (-) 672 WP_015417813.1 amyloid fiber anchoring/assembly protein TapA -
  BAM5036_RS11405 (BAM5036_2220) - 2419918..2420247 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  BAM5036_RS11410 (BAM5036_2221) - 2420287..2420466 (-) 180 WP_003153093.1 YqzE family protein -
  BAM5036_RS11415 (BAM5036_2222) comGG 2420523..2420900 (-) 378 WP_015417814.1 competence type IV pilus minor pilin ComGG Machinery gene
  BAM5036_RS11420 (BAM5036_2223) comGF 2420901..2421401 (-) 501 WP_258548905.1 competence type IV pilus minor pilin ComGF -
  BAM5036_RS11425 (BAM5036_2224) comGE 2421310..2421624 (-) 315 WP_031378943.1 competence type IV pilus minor pilin ComGE -
  BAM5036_RS11430 (BAM5036_2225) comGD 2421608..2422045 (-) 438 WP_015417817.1 competence type IV pilus minor pilin ComGD Machinery gene
  BAM5036_RS11435 (BAM5036_2226) comGC 2422035..2422301 (-) 267 WP_050515801.1 competence type IV pilus major pilin ComGC Machinery gene
  BAM5036_RS11440 (BAM5036_2227) comGB 2422348..2423385 (-) 1038 WP_015417819.1 competence type IV pilus assembly protein ComGB Machinery gene
  BAM5036_RS11445 (BAM5036_2228) comGA 2423372..2424442 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  BAM5036_RS11450 (BAM5036_2229) - 2424635..2425585 (-) 951 WP_015417820.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14167.09 Da        Isoelectric Point: 9.7165

>NTDB_id=56379 BAM5036_RS11415 WP_015417814.1 2420523..2420900(-) (comGG) [Bacillus velezensis UCMB5036]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGALLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=56379 BAM5036_RS11415 WP_015417814.1 2420523..2420900(-) (comGG) [Bacillus velezensis UCMB5036]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
ATCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCAGGGGAGTACTGGATCGGAGAGAACCTGCTCCAAAACGGCG
CGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACCACGACAGGTACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

50.806

99.2

0.504

Multiple sequence alignment