Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | BAM5036_RS11380 | Genome accession | NC_020410 |
| Coordinates | 2416992..2417165 (+) | Length | 57 a.a. |
| NCBI ID | WP_003153105.1 | Uniprot ID | A7Z6M7 |
| Organism | Bacillus velezensis UCMB5036 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2411992..2422165
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAM5036_RS11365 (BAM5036_2211) | gcvT | 2412805..2413905 (-) | 1101 | WP_015417809.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| BAM5036_RS11370 (BAM5036_2212) | - | 2414329..2415999 (+) | 1671 | WP_015417810.1 | DEAD/DEAH box helicase | - |
| BAM5036_RS11375 (BAM5036_2213) | - | 2416021..2416815 (+) | 795 | WP_015417811.1 | YqhG family protein | - |
| BAM5036_RS11380 (BAM5036_2214) | sinI | 2416992..2417165 (+) | 174 | WP_003153105.1 | anti-repressor SinI | Regulator |
| BAM5036_RS11385 (BAM5036_2215) | sinR | 2417199..2417534 (+) | 336 | WP_003153104.1 | transcriptional regulator SinR | Regulator |
| BAM5036_RS11390 (BAM5036_2216) | tasA | 2417582..2418367 (-) | 786 | WP_007408329.1 | biofilm matrix protein TasA | - |
| BAM5036_RS11395 (BAM5036_2217) | sipW | 2418432..2419016 (-) | 585 | WP_015240205.1 | signal peptidase I SipW | - |
| BAM5036_RS11400 (BAM5036_2218) | tapA | 2418988..2419659 (-) | 672 | WP_015417813.1 | amyloid fiber anchoring/assembly protein TapA | - |
| BAM5036_RS11405 (BAM5036_2220) | - | 2419918..2420247 (+) | 330 | WP_012117979.1 | DUF3889 domain-containing protein | - |
| BAM5036_RS11410 (BAM5036_2221) | - | 2420287..2420466 (-) | 180 | WP_003153093.1 | YqzE family protein | - |
| BAM5036_RS11415 (BAM5036_2222) | comGG | 2420523..2420900 (-) | 378 | WP_015417814.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| BAM5036_RS11420 (BAM5036_2223) | comGF | 2420901..2421401 (-) | 501 | WP_258548905.1 | competence type IV pilus minor pilin ComGF | - |
| BAM5036_RS11425 (BAM5036_2224) | comGE | 2421310..2421624 (-) | 315 | WP_031378943.1 | competence type IV pilus minor pilin ComGE | - |
| BAM5036_RS11430 (BAM5036_2225) | comGD | 2421608..2422045 (-) | 438 | WP_015417817.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6695.72 Da Isoelectric Point: 9.8170
>NTDB_id=56377 BAM5036_RS11380 WP_003153105.1 2416992..2417165(+) (sinI) [Bacillus velezensis UCMB5036]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=56377 BAM5036_RS11380 WP_003153105.1 2416992..2417165(+) (sinI) [Bacillus velezensis UCMB5036]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
70.175 |
100 |
0.702 |