Detailed information
Bioinformatically predicted
Overview
| Name | comE1/comEA | Type | Machinery gene |
| Locus tag | J7655_RS10075 | Genome accession | NZ_CP072610 |
| Coordinates | 2192813..2193133 (+) | Length | 106 a.a. |
| NCBI ID | WP_230927616.1 | Uniprot ID | - |
| Organism | Pseudomonas wenzhouensis strain A20 | ||
| Function | dsDNA binding (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 2120834..2202358 | 2192813..2193133 | within | 0 |
Gene organization within MGE regions
Location: 2120834..2202358
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J7655_RS09775 (J7655_09755) | ihfA | 2120834..2121136 (+) | 303 | WP_003243414.1 | integration host factor subunit alpha | - |
| J7655_RS09780 (J7655_09760) | - | 2121117..2121473 (+) | 357 | WP_230927578.1 | MerR family transcriptional regulator | - |
| J7655_RS09790 (J7655_09770) | - | 2121867..2122898 (-) | 1032 | WP_230927579.1 | AAA family ATPase | - |
| J7655_RS09795 (J7655_09775) | - | 2122883..2124445 (-) | 1563 | WP_230927580.1 | ATP-dependent nuclease | - |
| J7655_RS09800 (J7655_09780) | - | 2125302..2126456 (+) | 1155 | WP_230927581.1 | AAA family ATPase | - |
| J7655_RS09805 (J7655_09785) | - | 2126453..2127313 (+) | 861 | WP_230927582.1 | HNH endonuclease | - |
| J7655_RS09810 (J7655_09790) | - | 2127375..2127995 (-) | 621 | WP_230927583.1 | tyrosine-type recombinase/integrase | - |
| J7655_RS09815 (J7655_09795) | istA | 2128219..2129667 (+) | 1449 | Protein_1939 | IS21 family transposase | - |
| J7655_RS09820 (J7655_09800) | - | 2129755..2130845 (+) | 1091 | Protein_1940 | IS5-like element ISPa8 family transposase | - |
| J7655_RS09825 (J7655_09805) | istB | 2131078..2131833 (+) | 756 | WP_230927584.1 | IS21-like element helper ATPase IstB | - |
| J7655_RS09830 (J7655_09810) | - | 2131964..2132480 (-) | 517 | Protein_1942 | DDE-type integrase/transposase/recombinase | - |
| J7655_RS09835 (J7655_09815) | tnpC | 2132898..2134463 (-) | 1566 | WP_230927585.1 | IS66 family transposase | - |
| J7655_RS09840 (J7655_09820) | tnpB | 2134483..2134842 (-) | 360 | WP_003460146.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| J7655_RS09845 | - | 2134926..2135135 (+) | 210 | Protein_1945 | tyrosine-type recombinase/integrase | - |
| J7655_RS09850 (J7655_09825) | - | 2135307..2136170 (-) | 864 | WP_230927586.1 | hypothetical protein | - |
| J7655_RS09855 (J7655_09830) | - | 2136557..2136752 (+) | 196 | Protein_1947 | helix-turn-helix transcriptional regulator | - |
| J7655_RS09860 (J7655_09835) | - | 2137069..2137722 (+) | 654 | WP_023127664.1 | inovirus Gp2 family protein | - |
| J7655_RS09865 (J7655_09840) | - | 2137947..2139221 (-) | 1275 | WP_230927587.1 | Y-family DNA polymerase | - |
| J7655_RS09870 (J7655_09845) | - | 2139214..2139651 (-) | 438 | WP_216891514.1 | LexA family protein | - |
| J7655_RS09875 (J7655_09850) | - | 2139984..2140859 (-) | 876 | WP_230927588.1 | WYL domain-containing protein | - |
| J7655_RS09880 (J7655_09855) | - | 2140996..2141664 (+) | 669 | WP_230927589.1 | OB-fold protein | - |
| J7655_RS09885 (J7655_09860) | drmD | 2141880..2145101 (+) | 3222 | WP_230927590.1 | DISARM system SNF2-like helicase DrmD | - |
| J7655_RS09890 (J7655_09865) | - | 2145098..2150164 (+) | 5067 | WP_230927591.1 | Eco57I restriction-modification methylase domain-containing protein | - |
| J7655_RS09895 (J7655_09870) | - | 2150164..2156130 (+) | 5967 | WP_230927592.1 | DEAD/DEAH box helicase | - |
| J7655_RS09900 (J7655_09875) | - | 2156209..2157615 (+) | 1407 | WP_230927593.1 | DUF3696 domain-containing protein | - |
| J7655_RS09905 (J7655_09880) | - | 2157596..2158129 (+) | 534 | WP_230927594.1 | hypothetical protein | - |
| J7655_RS09910 (J7655_09885) | - | 2158141..2158833 (+) | 693 | WP_230927595.1 | RNA ligase family protein | - |
| J7655_RS09915 (J7655_09890) | - | 2158957..2160201 (+) | 1245 | WP_230927596.1 | hypothetical protein | - |
| J7655_RS09920 (J7655_09895) | - | 2160198..2160797 (+) | 600 | WP_230927597.1 | condensin complex protein MksE | - |
| J7655_RS09925 (J7655_09900) | - | 2160794..2163568 (+) | 2775 | WP_230927598.1 | hypothetical protein | - |
| J7655_RS09930 (J7655_09905) | - | 2163565..2164551 (+) | 987 | WP_230927599.1 | DUF7281 domain-containing protein | - |
| J7655_RS09935 | - | 2164654..2164836 (-) | 183 | WP_230927600.1 | hypothetical protein | - |
| J7655_RS09940 (J7655_09910) | radC | 2164846..2165343 (-) | 498 | WP_230927601.1 | RadC family protein | - |
| J7655_RS09945 (J7655_09915) | - | 2165315..2166265 (-) | 951 | WP_230927602.1 | hydrolase or metal-binding protein | - |
| J7655_RS09950 (J7655_09920) | - | 2166356..2167360 (-) | 1005 | WP_230927603.1 | YqaJ viral recombinase family protein | - |
| J7655_RS09955 (J7655_09925) | vapB | 2167517..2167747 (+) | 231 | WP_057391045.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| J7655_RS09960 (J7655_09930) | vapC | 2167747..2168151 (+) | 405 | WP_009408500.1 | type II toxin-antitoxin system tRNA(fMet)-specific endonuclease VapC | - |
| J7655_RS09965 (J7655_09935) | - | 2168238..2169206 (-) | 969 | WP_230927604.1 | DUF932 domain-containing protein | - |
| J7655_RS09975 (J7655_09940) | - | 2170001..2170273 (+) | 273 | WP_096862010.1 | CopG family ribbon-helix-helix protein | - |
| J7655_RS09980 (J7655_09945) | - | 2170261..2170554 (+) | 294 | WP_010953434.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| J7655_RS09985 (J7655_09950) | - | 2170548..2171411 (-) | 864 | Protein_1972 | site-specific integrase | - |
| J7655_RS09990 (J7655_09955) | - | 2171394..2171567 (-) | 174 | Protein_1973 | helix-turn-helix domain-containing protein | - |
| J7655_RS09995 (J7655_09960) | tnpA | 2171713..2172144 (+) | 432 | WP_230924495.1 | IS200/IS605 family transposase | - |
| J7655_RS10000 (J7655_09965) | - | 2172298..2173863 (+) | 1566 | WP_230927605.1 | TolC family protein | - |
| J7655_RS10005 (J7655_09970) | - | 2173863..2174612 (+) | 750 | WP_230927606.1 | efflux RND transporter periplasmic adaptor subunit | - |
| J7655_RS10010 (J7655_09975) | - | 2174652..2181677 (+) | 7026 | WP_230927607.1 | DUF4347 domain-containing protein | - |
| J7655_RS10015 (J7655_09980) | - | 2181687..2183033 (+) | 1347 | WP_230927608.1 | efflux RND transporter periplasmic adaptor subunit | - |
| J7655_RS10020 (J7655_09985) | - | 2183027..2185138 (+) | 2112 | WP_230927609.1 | HlyD family efflux transporter periplasmic adaptor subunit | - |
| J7655_RS10025 (J7655_09990) | - | 2185242..2185607 (-) | 366 | Protein_1980 | M20/M25/M40 family metallo-hydrolase | - |
| J7655_RS10030 (J7655_09995) | - | 2185882..2186298 (+) | 417 | WP_230927610.1 | hypothetical protein | - |
| J7655_RS10035 (J7655_10000) | - | 2186284..2187237 (-) | 954 | WP_230927611.1 | IS1595-like element ISAchd1 family transposase | - |
| J7655_RS10040 | - | 2187250..2187573 (+) | 324 | WP_230927612.1 | hypothetical protein | - |
| J7655_RS10045 (J7655_10010) | istA | 2187733..2189247 (+) | 1515 | WP_230925725.1 | IS21 family transposase | - |
| J7655_RS10050 (J7655_10015) | istB | 2189265..2190020 (+) | 756 | WP_230925724.1 | IS21-like element ISPpu7 family helper ATPase IstB | - |
| J7655_RS10055 (J7655_10020) | - | 2190292..2190564 (+) | 273 | WP_230927613.1 | CopG family ribbon-helix-helix protein | - |
| J7655_RS10060 (J7655_10025) | - | 2190552..2190845 (+) | 294 | WP_230927614.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| J7655_RS10065 (J7655_10030) | - | 2190839..2192248 (-) | 1410 | WP_230927615.1 | tyrosine-type recombinase/integrase | - |
| J7655_RS21000 | - | 2192458..2192667 (+) | 210 | WP_420850924.1 | hypothetical protein | - |
| J7655_RS21005 (J7655_10035) | - | 2192595..2192741 (-) | 147 | Protein_1990 | site-specific integrase | - |
| J7655_RS10075 (J7655_10040) | comE1/comEA | 2192813..2193133 (+) | 321 | WP_230927616.1 | ComEA family DNA-binding protein | Machinery gene |
| J7655_RS10080 (J7655_10045) | recC | 2193292..2196705 (+) | 3414 | WP_230927617.1 | exodeoxyribonuclease V subunit gamma | - |
| J7655_RS10085 (J7655_10050) | recB | 2196702..2200331 (+) | 3630 | WP_230927618.1 | exodeoxyribonuclease V subunit beta | - |
| J7655_RS10090 (J7655_10055) | recD | 2200328..2202358 (+) | 2031 | WP_230927619.1 | exodeoxyribonuclease V subunit alpha | - |
Sequence
Protein
Download Length: 106 a.a. Molecular weight: 11027.32 Da Isoelectric Point: 4.3988
>NTDB_id=554564 J7655_RS10075 WP_230927616.1 2192813..2193133(+) (comE1/comEA) [Pseudomonas wenzhouensis strain A20]
MKNYLSSVLFALLASFSFAVSAVDTGNAEAGEATSAQVTQAVTVNLNTADAETLQHELAGIGATKAQAIVAYREAHGSFA
SVDELLEVKGIGEATLNKNRDKLVVD
MKNYLSSVLFALLASFSFAVSAVDTGNAEAGEATSAQVTQAVTVNLNTADAETLQHELAGIGATKAQAIVAYREAHGSFA
SVDELLEVKGIGEATLNKNRDKLVVD
Nucleotide
Download Length: 321 bp
>NTDB_id=554564 J7655_RS10075 WP_230927616.1 2192813..2193133(+) (comE1/comEA) [Pseudomonas wenzhouensis strain A20]
ATGAAAAACTACCTCTCTTCTGTCCTCTTTGCGCTTCTTGCCTCTTTCTCCTTCGCTGTATCCGCAGTCGACACTGGAAA
CGCCGAGGCTGGCGAAGCGACCTCCGCGCAAGTCACTCAGGCTGTAACCGTCAATCTCAATACTGCTGATGCCGAGACGC
TCCAGCATGAGCTGGCGGGTATCGGTGCAACCAAAGCTCAGGCAATCGTGGCCTATCGTGAGGCTCATGGCAGTTTTGCT
TCTGTTGACGAACTGCTTGAGGTCAAGGGTATTGGTGAGGCGACTCTGAATAAGAATCGCGACAAACTGGTAGTCGACTG
A
ATGAAAAACTACCTCTCTTCTGTCCTCTTTGCGCTTCTTGCCTCTTTCTCCTTCGCTGTATCCGCAGTCGACACTGGAAA
CGCCGAGGCTGGCGAAGCGACCTCCGCGCAAGTCACTCAGGCTGTAACCGTCAATCTCAATACTGCTGATGCCGAGACGC
TCCAGCATGAGCTGGCGGGTATCGGTGCAACCAAAGCTCAGGCAATCGTGGCCTATCGTGAGGCTCATGGCAGTTTTGCT
TCTGTTGACGAACTGCTTGAGGTCAAGGGTATTGGTGAGGCGACTCTGAATAAGAATCGCGACAAACTGGTAGTCGACTG
A
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comE1/comEA | Haemophilus influenzae Rd KW20 |
47.748 |
100 |
0.5 |
| comEA/comE1 | Glaesserella parasuis strain SC1401 |
44.545 |
100 |
0.462 |
| comEA | Legionella pneumophila str. Paris |
41.414 |
93.396 |
0.387 |
| comEA | Legionella pneumophila strain ERS1305867 |
41.414 |
93.396 |
0.387 |
| comEA | Streptococcus thermophilus LMD-9 |
45.977 |
82.075 |
0.377 |
| comEA | Vibrio cholerae strain A1552 |
53.333 |
70.755 |
0.377 |
| comEA | Vibrio cholerae C6706 |
53.333 |
70.755 |
0.377 |
| comEA | Acinetobacter baylyi ADP1 |
46.988 |
78.302 |
0.368 |