Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | J7T63_RS01500 | Genome accession | NZ_CP072442 |
| Coordinates | 274398..274607 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain S24726 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 269398..279607
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J7T63_RS01470 (J7T63_01470) | - | 269836..270345 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| J7T63_RS01475 (J7T63_01475) | - | 270657..271214 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| J7T63_RS01480 (J7T63_01480) | - | 271217..271867 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| J7T63_RS01485 (J7T63_01485) | comR | 272062..272961 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| J7T63_RS01490 | - | 273199..273630 (+) | 432 | Protein_240 | cysteine peptidase family C39 domain-containing protein | - |
| J7T63_RS01495 | - | 273660..274376 (+) | 717 | Protein_241 | ABC transporter transmembrane domain-containing protein | - |
| J7T63_RS01500 | comA | 274398..274607 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| J7T63_RS01505 (J7T63_01510) | - | 274662..275230 (+) | 569 | Protein_243 | ATP-binding cassette domain-containing protein | - |
| J7T63_RS01510 (J7T63_01515) | - | 275338..275655 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| J7T63_RS01515 | - | 275618..275902 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| J7T63_RS01520 | - | 276142..276444 (-) | 303 | WP_231910735.1 | hypothetical protein | - |
| J7T63_RS01525 | - | 276526..277038 (-) | 513 | WP_372429570.1 | hypothetical protein | - |
| J7T63_RS01530 (J7T63_01525) | - | 277443..277958 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| J7T63_RS01535 (J7T63_01530) | - | 277983..278285 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| J7T63_RS01540 (J7T63_01535) | - | 278297..278608 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=553319 J7T63_RS01500 WP_002946147.1 274398..274607(+) (comA) [Streptococcus thermophilus strain S24726]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=553319 J7T63_RS01500 WP_002946147.1 274398..274607(+) (comA) [Streptococcus thermophilus strain S24726]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |