Detailed information NTG0552663

Bioinformatically predicted

Overview

• Name: comYD
• Type: Machinery gene
• Locus tag: J7T92_RS08905
• Genome accession: NZ_CP072429
• Coordinates: 1699754..1700182 (-)
• Length: 142 a.a.
• NCBI ID: WP_011226626.1
• Uniprot ID: -
• Organism: Streptococcus thermophilus strain S24747
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 1694754..1705182

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
J7T92_RS08865 (J7T92_08840)	-	1694890..1695333 (-)	444	WP_041829335.1	hypothetical protein	-
J7T92_RS08870	-	1695407..1695745 (-)	339	WP_224103197.1	CPBP family intramembrane glutamic endopeptidase	-
J7T92_RS08875 (J7T92_08850)	-	1696077..1696274 (-)	198	WP_014727723.1	helix-turn-helix transcriptional regulator	-
J7T92_RS08880 (J7T92_08855)	-	1696523..1697716 (-)	1194	WP_014608740.1	acetate kinase	-
J7T92_RS08885 (J7T92_08860)	comYH	1697772..1698728 (-)	957	WP_372434691.1	class I SAM-dependent methyltransferase	Machinery gene
J7T92_RS08890 (J7T92_08865)	comGG	1698773..1699090 (-)	318	WP_011681685.1	competence type IV pilus minor pilin ComGG	-
J7T92_RS08895 (J7T92_08870)	comYF	1699068..1699505 (-)	438	WP_011681686.1	competence type IV pilus minor pilin ComGF	Machinery gene
J7T92_RS08900 (J7T92_08875)	comGE	1699489..1699782 (-)	294	WP_011226625.1	competence type IV pilus minor pilin ComGE	-
J7T92_RS08905 (J7T92_08880)	comYD	1699754..1700182 (-)	429	WP_011226626.1	competence type IV pilus minor pilin ComGD	Machinery gene
J7T92_RS08910 (J7T92_08885)	comYC	1700142..1700468 (-)	327	WP_002946126.1	competence type IV pilus major pilin ComGC	Machinery gene
J7T92_RS08915 (J7T92_08890)	comGB	1700465..1701564 (-)	1100	Protein_1699	competence type IV pilus assembly protein ComGB	-
J7T92_RS08920 (J7T92_08895)	comGA/cglA/cilD	1701446..1702387 (-)	942	WP_071417491.1	competence type IV pilus ATPase ComGA	Machinery gene
J7T92_RS08925 (J7T92_08900)	-	1702468..1702830 (-)	363	WP_014622006.1	DUF1033 family protein	-

Sequence

Protein

• Length: 142 a.a.
• Molecular weight: 15859.45 Da
• Isoelectric Point: 10.3330

>NTDB_id=552663 J7T92_RS08905 WP_011226626.1 1699754..1700182(-) (comYD) [Streptococcus thermophilus strain S24747]
MRNMVVKAAQWPIRAFTLLESLMTLAVVVFLTLSLSGSVTGIFQQVEINLFYLRFEYLYRDSQRLASAEGSNVELQLTKD
KVSNGRSSLLIPKSIHLDKGQTLVFDAKGGNSSLTKIRFSSDKEVVTYLLNMGSGKYKKTIS

Nucleotide

• Length: 429 bp

>NTDB_id=552663 J7T92_RS08905 WP_011226626.1 1699754..1700182(-) (comYD) [Streptococcus thermophilus strain S24747]
ATGCGAAACATGGTGGTGAAAGCCGCTCAGTGGCCAATTAGAGCTTTCACCTTGTTGGAGAGCCTGATGACACTAGCAGT
GGTTGTCTTTCTCACTCTGAGTTTGTCAGGCTCAGTCACAGGTATTTTTCAGCAGGTCGAGATTAATCTTTTTTATCTGC
GTTTTGAGTACCTATATCGAGATAGTCAGCGCTTGGCATCAGCGGAAGGATCTAATGTTGAATTGCAGTTAACTAAGGAT
AAGGTTAGTAATGGAAGGTCTAGTCTGCTTATTCCTAAAAGTATTCATCTGGATAAGGGGCAGACGCTAGTGTTTGATGC
TAAAGGAGGCAACTCGAGCCTCACGAAAATTCGTTTTTCAAGTGATAAGGAGGTGGTGACCTATCTGCTTAACATGGGCA
GTGGTAAATATAAAAAGACGATCTCTTAG

Domains

No domain identified.

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comYD	Streptococcus mutans UA140	52.672	92.254	0.486
comYD	Streptococcus mutans UA159	52.672	92.254	0.486
comYD	Streptococcus gordonii str. Challis substr. CH1	41.429	98.592	0.408
comGD/cglD	Streptococcus pneumoniae Rx1	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae D39	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae R6	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis NCTC 12261	44.094	89.437	0.394
comGD/cglD	Streptococcus pneumoniae TIGR4	44.094	89.437	0.394
comGD/cglD	Streptococcus mitis SK321	43.307	89.437	0.387
comGD	Lactococcus lactis subsp. cremoris KW2	40.909	92.958	0.38