Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   J4Z27_RS11030 Genome accession   NZ_CP071992
Coordinates   2301588..2302061 (-) Length   157 a.a.
NCBI ID   WP_203262994.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain CBPA-ST-11003     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2259064..2314126 2301588..2302061 within 0


Gene organization within MGE regions


Location: 2259064..2314126
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  J4Z27_RS10745 (J4Z27_002139) - 2259064..2259738 (-) 675 WP_001832122.1 IS6 family transposase -
  J4Z27_RS10750 (J4Z27_002140) - 2259949..2260518 (-) 570 WP_002445778.1 TetR/AcrR family transcriptional regulator -
  J4Z27_RS10755 (J4Z27_002141) - 2260868..2261812 (-) 945 WP_001832065.1 glycine betaine ABC transporter substrate-binding protein -
  J4Z27_RS10760 (J4Z27_002142) - 2261836..2264517 (-) 2682 WP_002445777.1 MMPL family transporter -
  J4Z27_RS10765 (J4Z27_002143) - 2264978..2265916 (-) 939 WP_001832085.1 aldo/keto reductase -
  J4Z27_RS10770 (J4Z27_002144) hypR 2266073..2266495 (+) 423 WP_001832072.1 redox-sensitive transcriptional regulator HypR -
  J4Z27_RS10775 (J4Z27_002145) - 2266500..2266637 (+) 138 Protein_2094 FAD-binding protein -
  J4Z27_RS10780 (J4Z27_002146) - 2266795..2268258 (-) 1464 WP_233931972.1 N-acetylmuramoyl-L-alanine amidase -
  J4Z27_RS10785 (J4Z27_002147) - 2268268..2268564 (-) 297 WP_002504952.1 phage holin -
  J4Z27_RS10790 (J4Z27_002148) - 2268622..2270097 (-) 1476 WP_233931973.1 SGNH/GDSL hydrolase family protein -
  J4Z27_RS10795 (J4Z27_002149) - 2270144..2270290 (-) 147 WP_002497073.1 XkdX family protein -
  J4Z27_RS10800 (J4Z27_002150) - 2270292..2270618 (-) 327 WP_162153098.1 hypothetical protein -
  J4Z27_RS10805 (J4Z27_002151) - 2270636..2271700 (-) 1065 WP_233931974.1 BppU family phage baseplate upper protein -
  J4Z27_RS10810 (J4Z27_002152) - 2271755..2273536 (-) 1782 Protein_2101 glucosaminidase domain-containing protein -
  J4Z27_RS10815 (J4Z27_002153) - 2273649..2274269 (-) 621 WP_233931975.1 AP2 domain-containing protein -
  J4Z27_RS10820 (J4Z27_002154) - 2274485..2274622 (-) 138 WP_233931976.1 hypothetical protein -
  J4Z27_RS10825 (J4Z27_002155) - 2274675..2275073 (-) 399 WP_233931977.1 hypothetical protein -
  J4Z27_RS10830 (J4Z27_002156) - 2275054..2275476 (-) 423 WP_002475569.1 hypothetical protein -
  J4Z27_RS10835 (J4Z27_002157) - 2275490..2276677 (-) 1188 WP_233931978.1 BppU family phage baseplate upper protein -
  J4Z27_RS10840 (J4Z27_002158) - 2276690..2278576 (-) 1887 WP_233931979.1 M14 family metallopeptidase -
  J4Z27_RS10845 (J4Z27_002159) - 2278579..2280039 (-) 1461 WP_162153105.1 phage tail protein -
  J4Z27_RS10850 (J4Z27_002160) - 2280051..2281007 (-) 957 WP_195212724.1 phage tail domain-containing protein -
  J4Z27_RS10855 (J4Z27_002161) - 2281019..2284948 (-) 3930 WP_233931980.1 phage tail protein -
  J4Z27_RS10860 (J4Z27_002162) - 2284963..2285307 (-) 345 WP_017465060.1 hypothetical protein -
  J4Z27_RS10865 (J4Z27_002163) - 2285349..2285708 (-) 360 WP_002475585.1 tail assembly chaperone -
  J4Z27_RS10870 (J4Z27_002164) - 2285774..2286328 (-) 555 WP_233931981.1 phage major tail protein, TP901-1 family -
  J4Z27_RS10875 (J4Z27_002165) - 2286371..2286760 (-) 390 WP_103416128.1 hypothetical protein -
  J4Z27_RS10880 (J4Z27_002166) - 2286760..2287122 (-) 363 WP_233931983.1 HK97-gp10 family putative phage morphogenesis protein -
  J4Z27_RS10885 (J4Z27_002167) - 2287122..2287424 (-) 303 WP_233931984.1 hypothetical protein -
  J4Z27_RS10890 (J4Z27_002168) - 2287421..2287750 (-) 330 WP_002502853.1 phage head-tail connector protein -
  J4Z27_RS10895 (J4Z27_002169) - 2287752..2288021 (-) 270 WP_049401179.1 hypothetical protein -
  J4Z27_RS10900 (J4Z27_002170) - 2288042..2288971 (-) 930 WP_194373560.1 phage major capsid protein -
  J4Z27_RS10905 (J4Z27_002171) - 2288988..2289599 (-) 612 WP_233931985.1 DUF4355 domain-containing protein -
  J4Z27_RS10910 (J4Z27_002172) - 2289848..2289991 (-) 144 WP_233931986.1 hypothetical protein -
  J4Z27_RS10915 (J4Z27_002173) - 2289984..2290529 (-) 546 WP_193621159.1 hypothetical protein -
  J4Z27_RS10920 (J4Z27_002174) - 2290543..2291481 (-) 939 WP_233931987.1 minor capsid protein -
  J4Z27_RS10925 (J4Z27_002175) - 2291488..2293014 (-) 1527 WP_233931988.1 phage portal protein -
  J4Z27_RS10930 (J4Z27_002176) - 2293026..2294324 (-) 1299 WP_233931989.1 PBSX family phage terminase large subunit -
  J4Z27_RS10935 (J4Z27_002177) - 2294317..2294742 (-) 426 WP_151516556.1 terminase small subunit -
  J4Z27_RS10940 (J4Z27_002178) - 2294799..2295260 (-) 462 WP_151516557.1 hypothetical protein -
  J4Z27_RS10945 (J4Z27_002179) - 2295469..2295735 (-) 267 WP_151516558.1 hypothetical protein -
  J4Z27_RS10950 (J4Z27_002180) - 2295747..2296166 (-) 420 WP_233931990.1 transcriptional regulator -
  J4Z27_RS10955 (J4Z27_002181) - 2296185..2296403 (-) 219 WP_233931991.1 hypothetical protein -
  J4Z27_RS10960 (J4Z27_002182) - 2296407..2296547 (-) 141 WP_002469471.1 hypothetical protein -
  J4Z27_RS10965 (J4Z27_002183) - 2296535..2296933 (-) 399 WP_002469495.1 hypothetical protein -
  J4Z27_RS10970 (J4Z27_002184) rinB 2297139..2297309 (-) 171 WP_233931992.1 transcriptional activator RinB -
  J4Z27_RS10975 (J4Z27_002185) - 2297302..2297454 (-) 153 WP_233931993.1 DUF1381 domain-containing protein -
  J4Z27_RS10980 (J4Z27_002186) - 2297491..2298015 (-) 525 WP_233931994.1 dUTP diphosphatase -
  J4Z27_RS10985 (J4Z27_002187) - 2298016..2298177 (-) 162 WP_193621148.1 hypothetical protein -
  J4Z27_RS10990 (J4Z27_002188) - 2298177..2298398 (-) 222 WP_233931996.1 hypothetical protein -
  J4Z27_RS10995 (J4Z27_002189) - 2298388..2298660 (-) 273 WP_233931998.1 hypothetical protein -
  J4Z27_RS11000 (J4Z27_002190) - 2298661..2299008 (-) 348 WP_233931999.1 thermonuclease family protein -
  J4Z27_RS11005 (J4Z27_002191) - 2299009..2299398 (-) 390 WP_233932001.1 YopX family protein -
  J4Z27_RS11010 (J4Z27_002192) - 2299401..2299868 (-) 468 WP_233932002.1 DUF3310 domain-containing protein -
  J4Z27_RS11015 (J4Z27_002193) - 2299865..2300224 (-) 360 WP_233932003.1 SA1788 family PVL leukocidin-associated protein -
  J4Z27_RS11020 (J4Z27_002194) - 2300225..2300632 (-) 408 WP_233932004.1 RusA family crossover junction endodeoxyribonuclease -
  J4Z27_RS11025 (J4Z27_002195) - 2300671..2301558 (-) 888 WP_233932005.1 DnaD domain-containing protein -
  J4Z27_RS11030 (J4Z27_002196) ssbA 2301588..2302061 (-) 474 WP_203262994.1 single-stranded DNA-binding protein Machinery gene
  J4Z27_RS11035 (J4Z27_002197) - 2302062..2302679 (-) 618 WP_233932089.1 MBL fold metallo-hydrolase -
  J4Z27_RS11040 (J4Z27_002198) - 2302760..2303695 (-) 936 WP_233932006.1 recombinase RecT -
  J4Z27_RS11045 (J4Z27_002199) - 2303697..2305649 (-) 1953 WP_233932007.1 AAA family ATPase -
  J4Z27_RS11050 (J4Z27_002200) - 2305718..2305894 (-) 177 WP_233932008.1 hypothetical protein -
  J4Z27_RS11055 (J4Z27_002201) - 2305988..2306155 (-) 168 WP_233932009.1 hypothetical protein -
  J4Z27_RS11060 (J4Z27_002202) - 2306169..2306945 (-) 777 WP_233932010.1 phage antirepressor -
  J4Z27_RS11065 (J4Z27_002203) - 2306957..2307202 (-) 246 WP_233932011.1 helix-turn-helix transcriptional regulator -
  J4Z27_RS11070 (J4Z27_002204) - 2307369..2307683 (+) 315 WP_002486403.1 helix-turn-helix transcriptional regulator -
  J4Z27_RS11075 (J4Z27_002205) - 2307696..2308148 (+) 453 WP_049401135.1 ImmA/IrrE family metallo-endopeptidase -
  J4Z27_RS11080 (J4Z27_002206) - 2308153..2308677 (+) 525 WP_233932012.1 hypothetical protein -
  J4Z27_RS11085 (J4Z27_002207) - 2308679..2309260 (+) 582 WP_233932013.1 hypothetical protein -
  J4Z27_RS11090 (J4Z27_002208) - 2309313..2310689 (+) 1377 WP_233932015.1 recombinase family protein -
  J4Z27_RS11095 (J4Z27_002209) merA 2310680..2311918 (+) 1239 WP_413470871.1 hypothiocyanous acid reductase MerA -
  J4Z27_RS11100 (J4Z27_002210) - 2312498..2312839 (-) 342 WP_001832090.1 DUF1450 domain-containing protein -
  J4Z27_RS11105 (J4Z27_002211) - 2313050..2314126 (-) 1077 WP_001832075.1 phosphomevalonate kinase -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17654.35 Da        Isoelectric Point: 4.7621

>NTDB_id=549833 J4Z27_RS11030 WP_203262994.1 2301588..2302061(-) (ssbA) [Staphylococcus epidermidis strain CBPA-ST-11003]
MINRVVLVGRLTKDPEFRTTPNGVEVTNFTLAINRNFTNAQGEREADFINVITFRKQAVNVNDYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNANGSQQNDYYQQQSRAQQGQNRQQSNEPVGDNPFANANGPIDISDDDLPF

Nucleotide


Download         Length: 474 bp        

>NTDB_id=549833 J4Z27_RS11030 WP_203262994.1 2301588..2302061(-) (ssbA) [Staphylococcus epidermidis strain CBPA-ST-11003]
ATGATTAACAGAGTCGTATTAGTAGGTCGTTTAACTAAAGATCCAGAGTTTAGAACAACGCCTAACGGTGTTGAAGTAAC
AAACTTCACACTAGCGATTAATCGCAATTTCACAAACGCACAAGGCGAACGAGAAGCAGATTTTATAAACGTTATAACTT
TCAGAAAGCAAGCTGTAAACGTAAATGATTATTTATCTAAAGGAAAACTAGCAGGCGTTGATGGACGAATTCAATCACGC
AGCTATGAAAATCAAGAAGGTCGTCGAATTTTTGTTACTGAAGTTGTCGCAGATAGTGTTCAATTTCTTGAACCTAAAAA
TGCAAATGGTAGTCAACAAAATGATTACTACCAACAACAATCAAGAGCTCAGCAAGGACAAAACAGACAACAAAGCAATG
AACCGGTTGGAGATAACCCGTTTGCAAACGCTAATGGTCCAATTGATATTAGTGATGATGATTTACCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

59.302

100

0.65
  ssb Latilactobacillus sakei subsp. sakei 23K

50

100

0.541
  ssbB Bacillus subtilis subsp. subtilis str. 168

57.547

67.516

0.389
  ssb Neisseria meningitidis MC58

34.104

100

0.376
  ssb Neisseria gonorrhoeae MS11

34.104

100

0.376