Detailed information
Overview
| Name | comGD/cglD | Type | Machinery gene |
| Locus tag | J4Q31_RS10185 | Genome accession | NZ_CP071918 |
| Coordinates | 1947353..1947757 (-) | Length | 134 a.a. |
| NCBI ID | WP_000588005.1 | Uniprot ID | - |
| Organism | Streptococcus pneumoniae strain 19A-19343 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1948507..2000964 | 1947353..1947757 | flank | 750 |
Gene organization within MGE regions
Location: 1947353..2000964
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| J4Q31_RS10185 (J4Q31_10180) | comGD/cglD | 1947353..1947757 (-) | 405 | WP_000588005.1 | competence type IV pilus minor pilin ComGD | Machinery gene |
| J4Q31_RS10190 (J4Q31_10185) | comGC/cglC | 1947750..1948016 (-) | 267 | WP_000962026.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| J4Q31_RS10195 (J4Q31_10190) | - | 1948018..1948275 (-) | 258 | WP_000698513.1 | hypothetical protein | - |
| J4Q31_RS10200 (J4Q31_10195) | - | 1948507..1949463 (-) | 957 | WP_233923013.1 | N-acetylmuramoyl-L-alanine amidase family protein | - |
| J4Q31_RS10205 (J4Q31_10200) | - | 1949466..1949801 (-) | 336 | WP_050200954.1 | phage holin | - |
| J4Q31_RS10210 (J4Q31_10205) | - | 1949805..1950221 (-) | 417 | WP_001165344.1 | phage holin family protein | - |
| J4Q31_RS10215 (J4Q31_10210) | - | 1950231..1950581 (-) | 351 | WP_050200952.1 | hypothetical protein | - |
| J4Q31_RS10220 (J4Q31_10215) | - | 1950584..1950787 (-) | 204 | WP_001091109.1 | hypothetical protein | - |
| J4Q31_RS11780 | - | 1950768..1950884 (-) | 117 | WP_001063633.1 | hypothetical protein | - |
| J4Q31_RS10225 (J4Q31_10220) | - | 1950881..1959814 (-) | 8934 | WP_233984925.1 | tail fiber domain-containing protein | - |
| J4Q31_RS10230 (J4Q31_10230) | - | 1959819..1960169 (-) | 351 | WP_000068025.1 | DUF6711 family protein | - |
| J4Q31_RS10235 (J4Q31_10235) | - | 1960178..1963831 (-) | 3654 | WP_233922964.1 | hypothetical protein | - |
| J4Q31_RS10240 (J4Q31_10240) | - | 1963818..1964168 (-) | 351 | WP_000478016.1 | hypothetical protein | - |
| J4Q31_RS10245 (J4Q31_10245) | - | 1964207..1964587 (-) | 381 | WP_001185632.1 | DUF6096 family protein | - |
| J4Q31_RS10250 (J4Q31_10250) | - | 1964592..1965005 (-) | 414 | WP_000880676.1 | phage tail tube protein | - |
| J4Q31_RS10255 (J4Q31_10255) | - | 1965008..1965376 (-) | 369 | WP_000608235.1 | hypothetical protein | - |
| J4Q31_RS10260 (J4Q31_10260) | - | 1965373..1965888 (-) | 516 | WP_044812726.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| J4Q31_RS10265 (J4Q31_10265) | - | 1965863..1966201 (-) | 339 | WP_000478943.1 | hypothetical protein | - |
| J4Q31_RS10270 (J4Q31_10270) | - | 1966182..1966493 (-) | 312 | WP_000021221.1 | phage head-tail connector protein | - |
| J4Q31_RS10275 (J4Q31_10275) | - | 1966495..1966683 (-) | 189 | WP_000669348.1 | hypothetical protein | - |
| J4Q31_RS10280 (J4Q31_10280) | - | 1966673..1966855 (-) | 183 | WP_000054934.1 | Rho termination factor N-terminal domain-containing protein | - |
| J4Q31_RS10285 (J4Q31_10285) | - | 1966867..1967712 (-) | 846 | WP_000123890.1 | N4-gp56 family major capsid protein | - |
| J4Q31_RS10290 (J4Q31_10290) | - | 1967719..1968303 (-) | 585 | WP_001288026.1 | DUF4355 domain-containing protein | - |
| J4Q31_RS10295 (J4Q31_10295) | - | 1968520..1968771 (-) | 252 | WP_000890163.1 | DUF6275 family protein | - |
| J4Q31_RS10300 (J4Q31_10300) | - | 1968773..1969018 (-) | 246 | WP_050221455.1 | hypothetical protein | - |
| J4Q31_RS10305 (J4Q31_10305) | - | 1969070..1969297 (-) | 228 | WP_050110656.1 | hypothetical protein | - |
| J4Q31_RS10310 (J4Q31_10310) | - | 1969285..1970688 (-) | 1404 | WP_225791470.1 | minor capsid protein | - |
| J4Q31_RS10315 (J4Q31_10315) | - | 1970597..1972066 (-) | 1470 | WP_078730733.1 | phage portal protein | - |
| J4Q31_RS10320 (J4Q31_10320) | - | 1972078..1973376 (-) | 1299 | WP_000084426.1 | PBSX family phage terminase large subunit | - |
| J4Q31_RS10325 (J4Q31_10325) | - | 1973354..1973794 (-) | 441 | WP_001859583.1 | terminase small subunit | - |
| J4Q31_RS10335 (J4Q31_10335) | - | 1974268..1974690 (-) | 423 | WP_001030244.1 | DUF1492 domain-containing protein | - |
| J4Q31_RS10340 (J4Q31_10340) | - | 1974760..1975125 (-) | 366 | WP_000802874.1 | hypothetical protein | - |
| J4Q31_RS10345 (J4Q31_10345) | - | 1975122..1975442 (-) | 321 | WP_320408135.1 | 3-dehydroquinate synthase | - |
| J4Q31_RS10350 (J4Q31_10350) | - | 1975698..1975877 (-) | 180 | WP_001042650.1 | hypothetical protein | - |
| J4Q31_RS10355 (J4Q31_10355) | - | 1975870..1976364 (-) | 495 | WP_233922966.1 | YopX family protein | - |
| J4Q31_RS10360 (J4Q31_10360) | - | 1976361..1976879 (-) | 519 | WP_233922967.1 | DUF1642 domain-containing protein | - |
| J4Q31_RS10365 (J4Q31_10365) | - | 1976881..1977198 (-) | 318 | WP_174222359.1 | hypothetical protein | - |
| J4Q31_RS10370 (J4Q31_10370) | - | 1977223..1977405 (-) | 183 | WP_000796349.1 | hypothetical protein | - |
| J4Q31_RS10375 (J4Q31_10375) | - | 1977421..1977852 (-) | 432 | WP_000779143.1 | RusA family crossover junction endodeoxyribonuclease | - |
| J4Q31_RS10380 (J4Q31_10380) | - | 1977849..1978178 (-) | 330 | WP_050210841.1 | hypothetical protein | - |
| J4Q31_RS10385 (J4Q31_10385) | - | 1978192..1978401 (-) | 210 | WP_000455269.1 | hypothetical protein | - |
| J4Q31_RS10390 (J4Q31_10390) | - | 1978403..1979098 (-) | 696 | WP_050099130.1 | site-specific DNA-methyltransferase | - |
| J4Q31_RS10395 (J4Q31_10395) | ssbA | 1979111..1979527 (-) | 417 | WP_050201984.1 | single-stranded DNA-binding protein | Machinery gene |
| J4Q31_RS10400 (J4Q31_10400) | - | 1979517..1979660 (-) | 144 | WP_153277088.1 | hypothetical protein | - |
| J4Q31_RS10405 (J4Q31_10405) | - | 1979663..1980727 (-) | 1065 | WP_233922968.1 | DUF1351 domain-containing protein | - |
| J4Q31_RS10410 (J4Q31_10410) | bet | 1980737..1981489 (-) | 753 | WP_050263779.1 | phage recombination protein Bet | - |
| J4Q31_RS10415 (J4Q31_10415) | - | 1981507..1981692 (-) | 186 | WP_000746960.1 | hypothetical protein | - |
| J4Q31_RS10420 (J4Q31_10420) | - | 1981861..1982004 (-) | 144 | WP_001862963.1 | hypothetical protein | - |
| J4Q31_RS10425 (J4Q31_10425) | - | 1981991..1982251 (-) | 261 | WP_000471463.1 | hypothetical protein | - |
| J4Q31_RS10430 (J4Q31_10430) | - | 1982264..1982518 (-) | 255 | WP_000275521.1 | hypothetical protein | - |
| J4Q31_RS10435 (J4Q31_10435) | - | 1982519..1982740 (-) | 222 | WP_001864263.1 | hypothetical protein | - |
| J4Q31_RS10440 (J4Q31_10440) | - | 1982740..1982901 (-) | 162 | WP_000823399.1 | BOW99_gp33 family protein | - |
| J4Q31_RS10445 (J4Q31_10445) | - | 1982966..1983109 (-) | 144 | WP_001862958.1 | hypothetical protein | - |
| J4Q31_RS10450 (J4Q31_10450) | - | 1983226..1983450 (+) | 225 | WP_000517704.1 | DUF2188 domain-containing protein | - |
| J4Q31_RS10455 (J4Q31_10455) | - | 1983447..1983629 (-) | 183 | WP_001247797.1 | hypothetical protein | - |
| J4Q31_RS10460 (J4Q31_10460) | - | 1983811..1984089 (-) | 279 | WP_000261154.1 | HTH domain-containing protein | - |
| J4Q31_RS10465 (J4Q31_10465) | - | 1984256..1984492 (-) | 237 | WP_001157069.1 | hypothetical protein | - |
| J4Q31_RS11620 | - | 1984566..1984691 (+) | 126 | WP_257885839.1 | hypothetical protein | - |
| J4Q31_RS10470 (J4Q31_10475) | - | 1984684..1984983 (-) | 300 | WP_191855094.1 | hypothetical protein | - |
| J4Q31_RS10475 (J4Q31_10480) | - | 1985058..1985333 (-) | 276 | WP_050202804.1 | hypothetical protein | - |
| J4Q31_RS10480 (J4Q31_10485) | - | 1985494..1986246 (+) | 753 | WP_233922969.1 | XRE family transcriptional regulator | - |
| J4Q31_RS10485 (J4Q31_10490) | - | 1986248..1987012 (+) | 765 | WP_219576745.1 | hypothetical protein | - |
| J4Q31_RS10490 (J4Q31_10495) | - | 1987319..1988764 (+) | 1446 | WP_219576746.1 | recombinase family protein | - |
| J4Q31_RS10500 (J4Q31_10505) | comGB/cglB | 1988846..1989862 (-) | 1017 | WP_013193332.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| J4Q31_RS10505 (J4Q31_10510) | comGA/cglA/cilD | 1989810..1990751 (-) | 942 | WP_000249567.1 | competence type IV pilus ATPase ComGA | Machinery gene |
| J4Q31_RS10510 (J4Q31_10515) | - | 1990827..1991192 (-) | 366 | WP_000286415.1 | DUF1033 family protein | - |
| J4Q31_RS10515 (J4Q31_10520) | - | 1991343..1992401 (-) | 1059 | WP_000649468.1 | zinc-dependent alcohol dehydrogenase family protein | - |
| J4Q31_RS10520 (J4Q31_10525) | nagA | 1992564..1993715 (-) | 1152 | WP_001134457.1 | N-acetylglucosamine-6-phosphate deacetylase | - |
| J4Q31_RS10525 (J4Q31_10530) | - | 1993868..1995685 (-) | 1818 | WP_001220865.1 | acyltransferase family protein | - |
| J4Q31_RS10530 (J4Q31_10535) | tgt | 1995786..1996928 (-) | 1143 | WP_001285241.1 | tRNA guanosine(34) transglycosylase Tgt | - |
| J4Q31_RS10535 (J4Q31_10540) | - | 1997058..1997915 (+) | 858 | WP_001108863.1 | DUF975 family protein | - |
| J4Q31_RS10540 (J4Q31_10545) | pcp | 1997943..1998587 (-) | 645 | WP_000866916.1 | pyroglutamyl-peptidase I | - |
| J4Q31_RS10545 (J4Q31_10550) | - | 1998662..1999063 (-) | 402 | WP_000022864.1 | DUF1304 domain-containing protein | - |
| J4Q31_RS10550 (J4Q31_10555) | - | 1999074..1999499 (-) | 426 | WP_000890077.1 | MarR family winged helix-turn-helix transcriptional regulator | - |
| J4Q31_RS10555 (J4Q31_10560) | - | 1999822..2000964 (-) | 1143 | WP_000746976.1 | LysM domain-containing protein | - |
Sequence
Protein
Download Length: 134 a.a. Molecular weight: 14636.81 Da Isoelectric Point: 10.2164
>NTDB_id=549139 J4Q31_RS10185 WP_000588005.1 1947353..1947757(-) (comGD/cglD) [Streptococcus pneumoniae strain 19A-19343]
MIKAFTMLESLLALSLVSILALGLSGSVQSTFAAVEEQIFFMEFEELYRETQKRSVASQQKTSLNLDGQTISNGSQKLPV
PKGIQAPSGQSITFDRAGGNSSLAKVEFQTSKGAIRYQLYLGNGKIKRIKETKN
MIKAFTMLESLLALSLVSILALGLSGSVQSTFAAVEEQIFFMEFEELYRETQKRSVASQQKTSLNLDGQTISNGSQKLPV
PKGIQAPSGQSITFDRAGGNSSLAKVEFQTSKGAIRYQLYLGNGKIKRIKETKN
Nucleotide
Download Length: 405 bp
>NTDB_id=549139 J4Q31_RS10185 WP_000588005.1 1947353..1947757(-) (comGD/cglD) [Streptococcus pneumoniae strain 19A-19343]
ATGATTAAGGCCTTTACCATGCTGGAAAGTCTCTTGGCTTTGAGTCTTGTGAGTATCCTTGCCTTGGGCTTGTCCGGCTC
TGTTCAGTCCACTTTTGCGGCAGTAGAGGAACAGATTTTCTTTATGGAGTTTGAAGAACTCTATCGGGAAACCCAAAAAC
GCAGTGTAGCCAGTCAGCAAAAGACTAGTCTGAACTTAGATGGGCAGACGATTAGCAATGGCAGTCAAAAGTTGCCAGTC
CCTAAAGGAATTCAGGCCCCATCAGGCCAAAGTATTACATTTGACCGTGCTGGGGGCAATTCGTCCCTGGCTAAGGTTGA
ATTTCAGACCAGTAAAGGAGCGATTCGCTATCAATTATATCTAGGAAATGGAAAAATTAAACGCATTAAGGAAACAAAAA
ATTAG
ATGATTAAGGCCTTTACCATGCTGGAAAGTCTCTTGGCTTTGAGTCTTGTGAGTATCCTTGCCTTGGGCTTGTCCGGCTC
TGTTCAGTCCACTTTTGCGGCAGTAGAGGAACAGATTTTCTTTATGGAGTTTGAAGAACTCTATCGGGAAACCCAAAAAC
GCAGTGTAGCCAGTCAGCAAAAGACTAGTCTGAACTTAGATGGGCAGACGATTAGCAATGGCAGTCAAAAGTTGCCAGTC
CCTAAAGGAATTCAGGCCCCATCAGGCCAAAGTATTACATTTGACCGTGCTGGGGGCAATTCGTCCCTGGCTAAGGTTGA
ATTTCAGACCAGTAAAGGAGCGATTCGCTATCAATTATATCTAGGAAATGGAAAAATTAAACGCATTAAGGAAACAAAAA
ATTAG
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGD/cglD | Streptococcus pneumoniae TIGR4 |
97.015 |
100 |
0.97 |
| comGD/cglD | Streptococcus pneumoniae Rx1 |
96.269 |
100 |
0.963 |
| comGD/cglD | Streptococcus pneumoniae D39 |
96.269 |
100 |
0.963 |
| comGD/cglD | Streptococcus pneumoniae R6 |
96.269 |
100 |
0.963 |
| comGD/cglD | Streptococcus mitis NCTC 12261 |
96.241 |
99.254 |
0.955 |
| comGD/cglD | Streptococcus mitis SK321 |
95.522 |
100 |
0.955 |
| comYD | Streptococcus gordonii str. Challis substr. CH1 |
59.055 |
94.776 |
0.56 |
| comYD | Streptococcus mutans UA140 |
50 |
95.522 |
0.478 |
| comYD | Streptococcus mutans UA159 |
50 |
95.522 |
0.478 |