Detailed information
Bioinformatically predicted
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | AXY_RS01070 | Genome accession | NC_018704 |
| Coordinates | 196707..197162 (+) | Length | 151 a.a. |
| NCBI ID | WP_015008932.1 | Uniprot ID | K0J1F5 |
| Organism | Amphibacillus xylanus NBRC 15112 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 183295..240728 | 196707..197162 | within | 0 |
Gene organization within MGE regions
Location: 183295..240728
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AXY_RS00970 (AXY_01800) | - | 183295..183510 (+) | 216 | WP_015008918.1 | hypothetical protein | - |
| AXY_RS01010 (AXY_01810) | - | 189410..190570 (-) | 1161 | WP_015008919.1 | site-specific integrase | - |
| AXY_RS01015 (AXY_01820) | - | 190651..191124 (-) | 474 | WP_015008920.1 | ImmA/IrrE family metallo-endopeptidase | - |
| AXY_RS01020 (AXY_01830) | - | 191129..191449 (-) | 321 | WP_015008921.1 | helix-turn-helix domain-containing protein | - |
| AXY_RS13055 | - | 191867..191998 (+) | 132 | WP_269447584.1 | hypothetical protein | - |
| AXY_RS01025 (AXY_01840) | - | 191981..192310 (-) | 330 | WP_041450062.1 | hypothetical protein | - |
| AXY_RS01030 (AXY_01850) | - | 192374..192556 (+) | 183 | WP_015008923.1 | helix-turn-helix transcriptional regulator | - |
| AXY_RS01035 (AXY_01860) | - | 192570..192764 (+) | 195 | WP_015008924.1 | hypothetical protein | - |
| AXY_RS01040 (AXY_01870) | - | 192826..193152 (+) | 327 | WP_015008925.1 | hypothetical protein | - |
| AXY_RS01045 (AXY_01880) | - | 193244..194041 (+) | 798 | WP_015008926.1 | hypothetical protein | - |
| AXY_RS01050 (AXY_01890) | - | 194042..194302 (+) | 261 | WP_015008927.1 | hypothetical protein | - |
| AXY_RS12700 (AXY_01900) | - | 194310..194471 (+) | 162 | WP_015008928.1 | hypothetical protein | - |
| AXY_RS01055 (AXY_01910) | - | 194458..195210 (+) | 753 | WP_015008929.1 | phage antirepressor KilAC domain-containing protein | - |
| AXY_RS12160 (AXY_01920) | - | 195284..196333 (+) | 1050 | WP_015008930.1 | DnaD domain protein | - |
| AXY_RS01065 (AXY_01930) | - | 196326..196688 (+) | 363 | WP_231841358.1 | HNH endonuclease | - |
| AXY_RS01070 (AXY_01940) | ssbA | 196707..197162 (+) | 456 | WP_015008932.1 | single-stranded DNA-binding protein | Machinery gene |
| AXY_RS01075 (AXY_01950) | - | 197172..197441 (+) | 270 | WP_015008933.1 | hypothetical protein | - |
| AXY_RS01080 (AXY_01960) | - | 197883..198188 (+) | 306 | WP_015008934.1 | hypothetical protein | - |
| AXY_RS01085 (AXY_01970) | - | 198239..198760 (+) | 522 | Protein_196 | hypothetical protein | - |
| AXY_RS01090 (AXY_01980) | - | 198970..199308 (+) | 339 | WP_015008936.1 | MazG-like family protein | - |
| AXY_RS01095 (AXY_01990) | - | 199324..199737 (+) | 414 | WP_015008937.1 | hypothetical protein | - |
| AXY_RS01100 (AXY_02000) | - | 199794..200234 (+) | 441 | WP_015008938.1 | hypothetical protein | - |
| AXY_RS01105 (AXY_02010) | - | 200869..201087 (+) | 219 | WP_015008939.1 | hypothetical protein | - |
| AXY_RS01110 (AXY_02020) | - | 201199..202029 (+) | 831 | WP_172634997.1 | hypothetical protein | - |
| AXY_RS01115 (AXY_02030) | - | 202211..203134 (+) | 924 | WP_015008941.1 | DUF4868 domain-containing protein | - |
| AXY_RS01120 (AXY_02040) | - | 203157..203702 (+) | 546 | WP_015008942.1 | hypothetical protein | - |
| AXY_RS01125 (AXY_02050) | - | 203786..204085 (+) | 300 | WP_015008943.1 | hypothetical protein | - |
| AXY_RS01130 (AXY_02060) | - | 204160..204339 (+) | 180 | WP_015008944.1 | hypothetical protein | - |
| AXY_RS01135 (AXY_02070) | - | 204345..204767 (+) | 423 | WP_041450063.1 | hypothetical protein | - |
| AXY_RS01140 (AXY_02080) | - | 204898..205221 (+) | 324 | WP_015008946.1 | HNH endonuclease | - |
| AXY_RS01145 (AXY_02090) | - | 205328..205645 (+) | 318 | WP_015008947.1 | P27 family phage terminase small subunit | - |
| AXY_RS01150 (AXY_02100) | - | 205642..207312 (+) | 1671 | WP_015008948.1 | terminase TerL endonuclease subunit | - |
| AXY_RS01155 (AXY_02110) | - | 207616..208662 (+) | 1047 | WP_155835444.1 | phage portal protein | - |
| AXY_RS01160 (AXY_02120) | - | 208682..209404 (+) | 723 | WP_015008950.1 | head maturation protease, ClpP-related | - |
| AXY_RS01165 (AXY_02130) | - | 209411..210580 (+) | 1170 | WP_015008951.1 | phage major capsid protein | - |
| AXY_RS12885 (AXY_02140) | - | 210583..210738 (+) | 156 | WP_015008952.1 | hypothetical protein | - |
| AXY_RS01170 (AXY_02150) | - | 210744..211019 (+) | 276 | Protein_214 | hypothetical protein | - |
| AXY_RS01175 (AXY_02160) | - | 211069..211416 (+) | 348 | WP_015008954.1 | phage head closure protein | - |
| AXY_RS01180 (AXY_02170) | - | 211370..211801 (+) | 432 | WP_231841359.1 | HK97 gp10 family phage protein | - |
| AXY_RS01185 (AXY_02180) | - | 211809..212123 (+) | 315 | WP_015008956.1 | hypothetical protein | - |
| AXY_RS01190 (AXY_02190) | - | 212123..212695 (+) | 573 | WP_015008957.1 | major tail protein | - |
| AXY_RS01195 (AXY_02200) | - | 212699..213073 (+) | 375 | WP_015008958.1 | hypothetical protein | - |
| AXY_RS12890 (AXY_02210) | - | 213148..213291 (+) | 144 | WP_172634994.1 | hypothetical protein | - |
| AXY_RS12165 (AXY_02220) | - | 213473..216946 (+) | 3474 | WP_015008960.1 | phage tail tape measure protein | - |
| AXY_RS12170 (AXY_02230) | - | 216960..218393 (+) | 1434 | WP_015008961.1 | distal tail protein Dit | - |
| AXY_RS01210 (AXY_02240) | - | 218405..222022 (+) | 3618 | WP_015008962.1 | phage tail spike protein | - |
| AXY_RS01215 (AXY_02250) | - | 222019..222198 (+) | 180 | WP_015008963.1 | hypothetical protein | - |
| AXY_RS01220 (AXY_02260) | - | 222201..222431 (+) | 231 | WP_155835445.1 | hypothetical protein | - |
| AXY_RS01225 (AXY_02270) | - | 222504..222827 (+) | 324 | WP_015008965.1 | hypothetical protein | - |
| AXY_RS01230 (AXY_02280) | - | 222983..223129 (+) | 147 | WP_155835446.1 | hypothetical protein | - |
| AXY_RS01235 (AXY_02290) | - | 223204..223470 (+) | 267 | WP_015008967.1 | hypothetical protein | - |
| AXY_RS01240 (AXY_02300) | - | 223813..224265 (+) | 453 | WP_015008968.1 | holin family protein | - |
| AXY_RS12175 (AXY_02310) | - | 224318..225076 (+) | 759 | WP_015008969.1 | M23 family metallopeptidase | - |
| AXY_RS01255 (AXY_02320) | - | 225527..225910 (+) | 384 | WP_015008970.1 | hypothetical protein | - |
| AXY_RS01260 (AXY_02330) | - | 225949..226419 (+) | 471 | WP_015008971.1 | hypothetical protein | - |
| AXY_RS01265 (AXY_02340) | - | 226555..227646 (+) | 1092 | WP_015008972.1 | glycosyltransferase family 2 protein | - |
| AXY_RS01270 (AXY_02350) | - | 227694..228797 (-) | 1104 | WP_015008973.1 | polysaccharide pyruvyl transferase family protein | - |
| AXY_RS01275 (AXY_02360) | - | 228822..229850 (-) | 1029 | WP_015008974.1 | glycosyltransferase family 2 protein | - |
| AXY_RS01280 (AXY_02370) | - | 230093..232366 (-) | 2274 | WP_015008975.1 | hypothetical protein | - |
| AXY_RS01310 (AXY_02380) | cdaA | 233664..234485 (+) | 822 | WP_015008976.1 | diadenylate cyclase CdaA | - |
| AXY_RS01315 (AXY_02390) | - | 234482..235726 (+) | 1245 | WP_015008977.1 | YbbR-like domain-containing protein | - |
| AXY_RS01320 (AXY_02400) | glmM | 235765..237111 (+) | 1347 | WP_041450065.1 | phosphoglucosamine mutase | - |
| AXY_RS01325 (AXY_02410) | - | 237176..237715 (-) | 540 | WP_015008979.1 | cupin domain-containing protein | - |
| AXY_RS01330 (AXY_02420) | chrA | 237874..239061 (+) | 1188 | WP_015008980.1 | chromate efflux transporter | - |
| AXY_RS01335 (AXY_02430) | - | 239127..239618 (-) | 492 | WP_015008981.1 | LURP-one-related/scramblase family protein | - |
| AXY_RS01340 (AXY_02440) | - | 239856..240728 (+) | 873 | WP_015008982.1 | aminoglycoside 6-adenylyltransferase | - |
Sequence
Protein
Download Length: 151 a.a. Molecular weight: 16922.72 Da Isoelectric Point: 4.9205
>NTDB_id=53808 AXY_RS01070 WP_015008932.1 196707..197162(+) (ssbA) [Amphibacillus xylanus NBRC 15112]
MLNRVVLVGRLTRDPDLRYTASGRAVANFTIAVNRPFTNQQGDKEADFINCVIWNKPAENLANYMSKGNLIGIDGNLQSR
SYDGQDGKRVFVTEVVAGSVQFLESKNKTASNQNNNQVMKQTQNNANENDAAFQYHEHIEPIDISDDELPF
MLNRVVLVGRLTRDPDLRYTASGRAVANFTIAVNRPFTNQQGDKEADFINCVIWNKPAENLANYMSKGNLIGIDGNLQSR
SYDGQDGKRVFVTEVVAGSVQFLESKNKTASNQNNNQVMKQTQNNANENDAAFQYHEHIEPIDISDDELPF
Nucleotide
Download Length: 456 bp
>NTDB_id=53808 AXY_RS01070 WP_015008932.1 196707..197162(+) (ssbA) [Amphibacillus xylanus NBRC 15112]
ATGTTAAACAGAGTTGTACTTGTAGGACGATTAACAAGAGATCCAGATCTAAGGTATACAGCCAGTGGTAGAGCTGTTGC
AAACTTTACTATCGCGGTAAATAGGCCATTTACTAACCAACAAGGAGATAAAGAAGCTGATTTTATAAATTGTGTCATCT
GGAATAAGCCAGCTGAAAACTTAGCTAATTACATGAGTAAGGGAAATTTGATCGGTATTGATGGCAATTTGCAATCAAGA
AGTTATGACGGACAAGACGGAAAACGAGTTTTTGTAACTGAAGTAGTAGCAGGATCAGTTCAATTTTTAGAATCAAAGAA
TAAAACTGCTAGTAATCAAAACAATAACCAAGTCATGAAGCAAACGCAAAATAACGCAAATGAAAACGATGCAGCGTTTC
AATACCACGAACATATTGAACCGATTGATATTTCAGATGATGAGTTGCCTTTTTGA
ATGTTAAACAGAGTTGTACTTGTAGGACGATTAACAAGAGATCCAGATCTAAGGTATACAGCCAGTGGTAGAGCTGTTGC
AAACTTTACTATCGCGGTAAATAGGCCATTTACTAACCAACAAGGAGATAAAGAAGCTGATTTTATAAATTGTGTCATCT
GGAATAAGCCAGCTGAAAACTTAGCTAATTACATGAGTAAGGGAAATTTGATCGGTATTGATGGCAATTTGCAATCAAGA
AGTTATGACGGACAAGACGGAAAACGAGTTTTTGTAACTGAAGTAGTAGCAGGATCAGTTCAATTTTTAGAATCAAAGAA
TAAAACTGCTAGTAATCAAAACAATAACCAAGTCATGAAGCAAACGCAAAATAACGCAAATGAAAACGATGCAGCGTTTC
AATACCACGAACATATTGAACCGATTGATATTTCAGATGATGAGTTGCCTTTTTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
51.685 |
100 |
0.609 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
52.941 |
100 |
0.596 |
| ssbA | Streptococcus mutans UA159 |
41.06 |
100 |
0.411 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
54.63 |
71.523 |
0.391 |
| ssb | Vibrio cholerae strain A1552 |
31.818 |
100 |
0.371 |