Detailed information
Bioinformatically predicted
Overview
| Name | ssb | Type | Machinery gene |
| Locus tag | D1099_RS04870 | Genome accession | NZ_CP069796 |
| Coordinates | 1025782..1026216 (+) | Length | 144 a.a. |
| NCBI ID | WP_005607789.1 | Uniprot ID | - |
| Organism | Actinobacillus pleuropneumoniae serovar 6 str. Femo | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1020843..1085927 | 1025782..1026216 | within | 0 |
Gene organization within MGE regions
Location: 1020843..1085927
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D1099_RS04850 (D1099_04815) | - | 1022259..1022810 (+) | 552 | WP_005607778.1 | DUF2857 domain-containing protein | - |
| D1099_RS04855 (D1099_04820) | - | 1022957..1024156 (+) | 1200 | WP_005607781.1 | STY4528 family pathogenicity island replication protein | - |
| D1099_RS04860 (D1099_04825) | - | 1024238..1024996 (+) | 759 | WP_005607783.1 | PFL_4669 family integrating conjugative element protein | - |
| D1099_RS04865 (D1099_04830) | - | 1025012..1025479 (+) | 468 | WP_005620769.1 | DUF3158 family protein | - |
| D1099_RS04870 (D1099_04835) | ssb | 1025782..1026216 (+) | 435 | WP_005607789.1 | single-stranded DNA-binding protein | Machinery gene |
| D1099_RS04875 (D1099_04840) | - | 1026335..1026979 (-) | 645 | WP_005607792.1 | plasmid fertility inhibition factor family protein | - |
| D1099_RS04880 (D1099_04845) | - | 1027144..1027641 (+) | 498 | WP_005607794.1 | hypothetical protein | - |
| D1099_RS04885 (D1099_04850) | - | 1027794..1029836 (+) | 2043 | WP_005607796.1 | DNA topoisomerase III | - |
| D1099_RS04890 (D1099_04855) | - | 1030706..1031155 (+) | 450 | WP_005607798.1 | STY4534 family ICE replication protein | - |
| D1099_RS04895 (D1099_04860) | - | 1031234..1031563 (+) | 330 | WP_005607801.1 | hypothetical protein | - |
| D1099_RS04900 (D1099_04865) | - | 1031642..1032289 (+) | 648 | WP_005620766.1 | DUF3560 domain-containing protein | - |
| D1099_RS04905 (D1099_04870) | - | 1032357..1032716 (+) | 360 | WP_005620763.1 | hypothetical protein | - |
| D1099_RS04910 (D1099_04875) | - | 1032871..1033512 (+) | 642 | WP_005620760.1 | hypothetical protein | - |
| D1099_RS04915 (D1099_04880) | - | 1033512..1034246 (+) | 735 | WP_005620758.1 | TIGR03759 family integrating conjugative element protein | - |
| D1099_RS04920 (D1099_04885) | - | 1034225..1035013 (+) | 789 | WP_005620755.1 | hypothetical protein | - |
| D1099_RS04925 (D1099_04890) | - | 1035025..1035528 (+) | 504 | WP_005607818.1 | integrating conjugative element protein | - |
| D1099_RS04930 (D1099_04895) | traD | 1035528..1037744 (+) | 2217 | WP_005607821.1 | type IV conjugative transfer system coupling protein TraD | - |
| D1099_RS04935 (D1099_04900) | - | 1037731..1038084 (+) | 354 | WP_005620752.1 | hypothetical protein | - |
| D1099_RS04940 (D1099_04905) | - | 1038081..1038779 (+) | 699 | WP_005607827.1 | TIGR03747 family integrating conjugative element membrane protein | - |
| D1099_RS04945 (D1099_04910) | - | 1038796..1039017 (+) | 222 | WP_039195117.1 | hypothetical protein | - |
| D1099_RS04950 (D1099_04915) | - | 1039082..1039417 (-) | 336 | WP_005620751.1 | hypothetical protein | - |
| D1099_RS04955 (D1099_04920) | - | 1039615..1039941 (+) | 327 | WP_005620750.1 | RAQPRD family integrative conjugative element protein | - |
| D1099_RS04960 (D1099_04925) | - | 1039941..1040183 (+) | 243 | WP_005620748.1 | DUF3262 family protein | - |
| D1099_RS04965 (D1099_04930) | - | 1040204..1040617 (+) | 414 | WP_005607831.1 | DUF2976 domain-containing protein | - |
| D1099_RS04970 (D1099_04935) | - | 1040647..1041018 (+) | 372 | WP_005607834.1 | TIGR03750 family conjugal transfer protein | - |
| D1099_RS04975 (D1099_04940) | - | 1041015..1041656 (+) | 642 | WP_005607836.1 | PFL_4703 family integrating conjugative element protein | - |
| D1099_RS04980 (D1099_04945) | - | 1041656..1042546 (+) | 891 | WP_005607840.1 | TIGR03749 family integrating conjugative element protein | - |
| D1099_RS04985 (D1099_04950) | - | 1042555..1044012 (+) | 1458 | WP_005607843.1 | TIGR03752 family integrating conjugative element protein | - |
| D1099_RS04990 (D1099_04955) | - | 1044023..1044421 (+) | 399 | WP_005607846.1 | TIGR03751 family conjugal transfer lipoprotein | - |
| D1099_RS04995 (D1099_04960) | - | 1044424..1047234 (+) | 2811 | WP_005620746.1 | conjugative transfer ATPase | - |
| D1099_RS05000 (D1099_04965) | - | 1047231..1047662 (+) | 432 | WP_005607852.1 | hypothetical protein | - |
| D1099_RS05005 (D1099_04970) | - | 1047649..1047975 (+) | 327 | WP_005607856.1 | hypothetical protein | - |
| D1099_RS05010 (D1099_04975) | - | 1047993..1049483 (+) | 1491 | WP_005607860.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| D1099_RS05015 (D1099_04980) | - | 1049519..1049905 (-) | 387 | WP_005607864.1 | hypothetical protein | - |
| D1099_RS05020 (D1099_04985) | - | 1050038..1050451 (-) | 414 | WP_005607867.1 | hypothetical protein | - |
| D1099_RS05025 (D1099_04990) | - | 1050473..1052473 (-) | 2001 | WP_005607871.1 | integrating conjugative element protein | - |
| D1099_RS05030 (D1099_04995) | - | 1052493..1053431 (-) | 939 | WP_005607875.1 | TIGR03756 family integrating conjugative element protein | - |
| D1099_RS05035 (D1099_05000) | - | 1053428..1053814 (-) | 387 | WP_051889504.1 | TIGR03757 family integrating conjugative element protein | - |
| D1099_RS05040 (D1099_05005) | - | 1054274..1054624 (+) | 351 | WP_005607882.1 | hypothetical protein | - |
| D1099_RS05045 (D1099_05010) | - | 1054698..1054949 (+) | 252 | WP_005620744.1 | hypothetical protein | - |
| D1099_RS05050 (D1099_05015) | - | 1055023..1055910 (+) | 888 | WP_005620743.1 | hypothetical protein | - |
| D1099_RS05055 (D1099_05020) | - | 1055986..1056957 (+) | 972 | WP_005620742.1 | ArdC family protein | - |
| D1099_RS05060 (D1099_05025) | - | 1057143..1057580 (-) | 438 | WP_005620741.1 | hypothetical protein | - |
| D1099_RS05065 (D1099_05030) | - | 1057600..1057881 (-) | 282 | WP_005620740.1 | hypothetical protein | - |
| D1099_RS05070 (D1099_05035) | - | 1058145..1058732 (+) | 588 | WP_005620738.1 | recombinase family protein | - |
| D1099_RS05075 (D1099_05040) | mobH | 1058831..1060744 (+) | 1914 | WP_005607899.1 | MobH family relaxase | - |
| D1099_RS05080 (D1099_05045) | - | 1060846..1061667 (+) | 822 | WP_371416485.1 | tyrosine-type recombinase/integrase | - |
| D1099_RS05085 (D1099_05050) | - | 1061828..1062376 (-) | 549 | WP_043992043.1 | PBECR4 domain-containing protein | - |
| D1099_RS05090 (D1099_05055) | uraH | 1062922..1063335 (-) | 414 | WP_005601104.1 | hydroxyisourate hydrolase | - |
| D1099_RS05095 (D1099_05060) | purR | 1063534..1064544 (+) | 1011 | WP_005597280.1 | HTH-type transcriptional repressor PurR | - |
| D1099_RS05100 (D1099_05065) | - | 1064567..1065169 (+) | 603 | WP_005597281.1 | DedA family protein | - |
| D1099_RS05105 (D1099_05070) | gyrB | 1065269..1067701 (-) | 2433 | WP_005597283.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
| D1099_RS05110 (D1099_05075) | ubiA | 1067914..1068795 (-) | 882 | WP_005601109.1 | 4-hydroxybenzoate octaprenyltransferase | - |
| D1099_RS05115 (D1099_05080) | - | 1068795..1069556 (-) | 762 | WP_005597287.1 | DeoR/GlpR family transcriptional regulator | - |
| D1099_RS05120 (D1099_05085) | purB | 1069624..1070991 (-) | 1368 | WP_005620733.1 | adenylosuccinate lyase | - |
| D1099_RS05125 (D1099_05090) | hflD | 1071048..1071680 (-) | 633 | WP_005597292.1 | high frequency lysogenization protein HflD | - |
| D1099_RS05130 (D1099_05095) | cydC | 1071845..1073512 (-) | 1668 | WP_005607915.1 | heme ABC transporter ATP-binding protein/permease CydC | - |
| D1099_RS05135 (D1099_05100) | cydD | 1073523..1075265 (-) | 1743 | WP_005607916.1 | heme ABC transporter permease/ATP-binding protein CydD | - |
| D1099_RS05140 (D1099_05105) | - | 1075425..1079384 (-) | 3960 | WP_005607920.1 | translocation/assembly module TamB domain-containing protein | - |
| D1099_RS05145 (D1099_05110) | - | 1079445..1081271 (-) | 1827 | WP_005607922.1 | autotransporter assembly complex protein TamA | - |
| D1099_RS05150 (D1099_05115) | - | 1081287..1082135 (-) | 849 | WP_005607924.1 | divergent polysaccharide deacetylase family protein | - |
| D1099_RS05155 (D1099_05120) | envC | 1082135..1083343 (-) | 1209 | WP_005607926.1 | murein hydrolase activator EnvC | - |
| D1099_RS05160 (D1099_05125) | - | 1083513..1084196 (+) | 684 | WP_005597307.1 | 2,3-diphosphoglycerate-dependent phosphoglycerate mutase | - |
| D1099_RS05165 (D1099_05130) | - | 1084280..1084915 (-) | 636 | WP_005620726.1 | LysE/ArgO family amino acid transporter | - |
| D1099_RS05170 (D1099_05135) | udk | 1085033..1085686 (+) | 654 | WP_005601135.1 | uridine kinase | - |
Sequence
Protein
Download Length: 144 a.a. Molecular weight: 16283.02 Da Isoelectric Point: 5.6770
>NTDB_id=536685 D1099_RS04870 WP_005607789.1 1025782..1026216(+) (ssb) [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
MAGINKVIIVGHLGNEPEMRTMPNGEAVANISVATSESWTDKTTGERREVTEWHRIVFYRRQAEVVGQYLHKGSQVYVEG
RLRTRKWQDQNGQDRYTTEIQGDILQMLGGRNNGTSPAPTQNQPTNAVNQTEPPINNFDDDIPF
MAGINKVIIVGHLGNEPEMRTMPNGEAVANISVATSESWTDKTTGERREVTEWHRIVFYRRQAEVVGQYLHKGSQVYVEG
RLRTRKWQDQNGQDRYTTEIQGDILQMLGGRNNGTSPAPTQNQPTNAVNQTEPPINNFDDDIPF
Nucleotide
Download Length: 435 bp
>NTDB_id=536685 D1099_RS04870 WP_005607789.1 1025782..1026216(+) (ssb) [Actinobacillus pleuropneumoniae serovar 6 str. Femo]
ATGGCTGGTATCAATAAAGTCATTATTGTTGGGCATCTCGGCAATGAACCTGAAATGCGAACTATGCCGAATGGTGAAGC
AGTTGCAAATATCAGTGTTGCAACAAGTGAAAGCTGGACGGATAAAACGACCGGAGAACGTCGTGAAGTAACAGAATGGC
ATCGAATTGTATTCTATCGCCGTCAAGCAGAAGTAGTTGGTCAATATCTCCACAAGGGTTCACAAGTATATGTAGAAGGC
CGTCTACGCACACGTAAATGGCAAGATCAGAATGGTCAAGATCGTTATACGACCGAAATTCAAGGTGATATATTACAAAT
GCTAGGTGGACGTAATAATGGAACTTCTCCTGCTCCAACACAAAATCAACCGACTAATGCAGTTAATCAAACGGAGCCTC
CGATAAATAACTTTGATGACGATATTCCGTTCTGA
ATGGCTGGTATCAATAAAGTCATTATTGTTGGGCATCTCGGCAATGAACCTGAAATGCGAACTATGCCGAATGGTGAAGC
AGTTGCAAATATCAGTGTTGCAACAAGTGAAAGCTGGACGGATAAAACGACCGGAGAACGTCGTGAAGTAACAGAATGGC
ATCGAATTGTATTCTATCGCCGTCAAGCAGAAGTAGTTGGTCAATATCTCCACAAGGGTTCACAAGTATATGTAGAAGGC
CGTCTACGCACACGTAAATGGCAAGATCAGAATGGTCAAGATCGTTATACGACCGAAATTCAAGGTGATATATTACAAAT
GCTAGGTGGACGTAATAATGGAACTTCTCCTGCTCCAACACAAAATCAACCGACTAATGCAGTTAATCAAACGGAGCCTC
CGATAAATAACTTTGATGACGATATTCCGTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssb | Glaesserella parasuis strain SC1401 |
62.778 |
100 |
0.785 |
| ssb | Vibrio cholerae strain A1552 |
52.601 |
100 |
0.632 |
| ssb | Neisseria meningitidis MC58 |
43.353 |
100 |
0.521 |
| ssb | Neisseria gonorrhoeae MS11 |
43.353 |
100 |
0.521 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
31.977 |
100 |
0.382 |