Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | JQR77_RS01580 | Genome accession | NZ_CP069275 |
| Coordinates | 282710..282919 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain EG007 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 277710..287919
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JQR77_RS01550 (JQR77_01530) | - | 278149..278658 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| JQR77_RS01555 (JQR77_01535) | - | 278969..279526 (+) | 558 | WP_011680718.1 | ECF transporter S component | - |
| JQR77_RS01560 (JQR77_01540) | - | 279529..280179 (+) | 651 | WP_011680719.1 | phosphatase PAP2 family protein | - |
| JQR77_RS01565 (JQR77_01545) | comR | 280374..281273 (+) | 900 | WP_023909392.1 | helix-turn-helix domain-containing protein | Regulator |
| JQR77_RS01570 (JQR77_01550) | - | 281511..282092 (+) | 582 | Protein_257 | cysteine peptidase family C39 domain-containing protein | - |
| JQR77_RS01575 (JQR77_01555) | comA | 282077..282367 (+) | 291 | WP_194238295.1 | ABC transporter transmembrane domain-containing protein | Regulator |
| JQR77_RS01580 | comA | 282710..282919 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| JQR77_RS01585 (JQR77_01565) | - | 282974..283542 (+) | 569 | Protein_260 | ATP-binding cassette domain-containing protein | - |
| JQR77_RS01590 | - | 283773..283961 (+) | 189 | WP_224103239.1 | hypothetical protein | - |
| JQR77_RS01595 | - | 283929..284213 (-) | 285 | WP_232557103.1 | hypothetical protein | - |
| JQR77_RS01600 | - | 284454..284756 (-) | 303 | WP_224103194.1 | hypothetical protein | - |
| JQR77_RS01605 | - | 284980..285351 (-) | 372 | WP_224103195.1 | hypothetical protein | - |
| JQR77_RS01610 (JQR77_01580) | - | 285757..286272 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| JQR77_RS01615 (JQR77_01585) | - | 286297..286599 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| JQR77_RS01620 (JQR77_01590) | - | 286611..286922 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=533190 JQR77_RS01580 WP_002946147.1 282710..282919(+) (comA) [Streptococcus thermophilus strain EG007]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=533190 JQR77_RS01580 WP_002946147.1 282710..282919(+) (comA) [Streptococcus thermophilus strain EG007]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |