Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   JQC88_RS08905 Genome accession   NZ_CP069215
Coordinates   1870794..1871267 (-) Length   157 a.a.
NCBI ID   WP_203262994.1    Uniprot ID   -
Organism   Staphylococcus epidermidis strain Z0118SE0269     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1836552..1881845 1870794..1871267 within 0


Gene organization within MGE regions


Location: 1836552..1881845
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JQC88_RS08665 - 1836552..1836893 (-) 342 WP_002456621.1 fatty acid desaturase -
  JQC88_RS08670 - 1837106..1837342 (-) 237 WP_001829451.1 hypothetical protein -
  JQC88_RS12440 - 1837544..1837795 (-) 252 WP_001829448.1 plasmid recombination protein -
  JQC88_RS12445 - 1837877..1838104 (-) 228 WP_080033396.1 plasmid recombination protein -
  JQC88_RS08685 - 1839149..1840552 (-) 1404 WP_103433372.1 N-acetylmuramoyl-L-alanine amidase -
  JQC88_RS08690 - 1840552..1840821 (-) 270 WP_002469117.1 phage holin -
  JQC88_RS08695 - 1840877..1841404 (-) 528 WP_001830238.1 hypothetical protein -
  JQC88_RS08700 - 1841404..1841913 (-) 510 WP_012099596.1 hypothetical protein -
  JQC88_RS08705 - 1841966..1843888 (-) 1923 WP_203262960.1 glucosaminidase domain-containing protein -
  JQC88_RS08710 - 1844023..1844322 (-) 300 WP_064604136.1 DUF2951 family protein -
  JQC88_RS08715 - 1844361..1844498 (-) 138 WP_107514072.1 XkdX family protein -
  JQC88_RS08720 - 1844491..1844826 (-) 336 WP_064604133.1 hypothetical protein -
  JQC88_RS08725 - 1844831..1846372 (-) 1542 WP_203262962.1 BppU family phage baseplate upper protein -
  JQC88_RS08730 - 1846372..1849038 (-) 2667 WP_203262963.1 peptidase G2 autoproteolytic cleavage domain-containing protein -
  JQC88_RS08735 - 1849053..1850924 (-) 1872 WP_203262964.1 SGNH/GDSL hydrolase family protein -
  JQC88_RS08740 - 1850933..1851880 (-) 948 WP_203262965.1 phage tail domain-containing protein -
  JQC88_RS08745 - 1851892..1855665 (-) 3774 WP_203262966.1 phage tail protein -
  JQC88_RS08750 - 1855682..1856026 (-) 345 WP_064604115.1 hypothetical protein -
  JQC88_RS08755 - 1856074..1856442 (-) 369 WP_099800300.1 tail assembly chaperone -
  JQC88_RS08760 - 1856501..1857055 (-) 555 WP_107519414.1 phage major tail protein, TP901-1 family -
  JQC88_RS08765 - 1857111..1857497 (-) 387 WP_107514080.1 hypothetical protein -
  JQC88_RS08770 - 1857509..1857859 (-) 351 WP_203262967.1 HK97-gp10 family putative phage morphogenesis protein -
  JQC88_RS08775 - 1857859..1858161 (-) 303 WP_203262968.1 hypothetical protein -
  JQC88_RS08780 - 1858158..1858487 (-) 330 WP_064604097.1 phage head-tail connector protein -
  JQC88_RS08785 - 1858489..1858758 (-) 270 WP_203262969.1 hypothetical protein -
  JQC88_RS08790 - 1858774..1859706 (-) 933 WP_203262970.1 phage major capsid protein -
  JQC88_RS08795 - 1859722..1860333 (-) 612 WP_203262971.1 DUF4355 domain-containing protein -
  JQC88_RS08800 - 1860508..1860651 (-) 144 WP_203262973.1 hypothetical protein -
  JQC88_RS08805 - 1860648..1861598 (-) 951 WP_203262976.1 minor capsid protein -
  JQC88_RS08810 - 1861605..1863122 (-) 1518 WP_203262978.1 phage portal protein -
  JQC88_RS08815 - 1863133..1864413 (-) 1281 WP_203262979.1 PBSX family phage terminase large subunit -
  JQC88_RS08820 - 1864400..1864897 (-) 498 WP_099800266.1 terminase small subunit -
  JQC88_RS08825 - 1865068..1865334 (-) 267 WP_203262980.1 hypothetical protein -
  JQC88_RS08830 - 1865345..1865764 (-) 420 WP_061827622.1 transcriptional regulator -
  JQC88_RS08835 - 1865767..1865907 (-) 141 WP_002470855.1 hypothetical protein -
  JQC88_RS08840 - 1865895..1866293 (-) 399 WP_002468964.1 hypothetical protein -
  JQC88_RS08845 - 1866295..1866465 (-) 171 WP_203262981.1 transcriptional regulator -
  JQC88_RS08850 - 1866458..1866778 (-) 321 WP_203262982.1 hypothetical protein -
  JQC88_RS08855 - 1866784..1866996 (-) 213 WP_203262983.1 DUF1381 domain-containing protein -
  JQC88_RS08860 - 1867009..1867173 (-) 165 WP_203262984.1 hypothetical protein -
  JQC88_RS08865 - 1867210..1867737 (-) 528 WP_203262985.1 dUTP pyrophosphatase -
  JQC88_RS08870 - 1867730..1867909 (-) 180 WP_203262986.1 DUF1024 family protein -
  JQC88_RS08875 - 1867899..1868147 (-) 249 WP_203262987.1 hypothetical protein -
  JQC88_RS08880 - 1868137..1868424 (-) 288 WP_203262988.1 hypothetical protein -
  JQC88_RS12350 - 1868421..1868624 (-) 204 WP_238990533.1 hypothetical protein -
  JQC88_RS08885 - 1868614..1869066 (-) 453 WP_203262990.1 DUF3310 domain-containing protein -
  JQC88_RS08890 - 1869066..1869422 (-) 357 WP_203262991.1 SA1788 family PVL leukocidin-associated protein -
  JQC88_RS08895 - 1869423..1869830 (-) 408 WP_203262992.1 RusA family crossover junction endodeoxyribonuclease -
  JQC88_RS08900 - 1869868..1870764 (-) 897 WP_203262993.1 DnaD domain protein -
  JQC88_RS08905 ssbA 1870794..1871267 (-) 474 WP_203262994.1 single-stranded DNA-binding protein Machinery gene
  JQC88_RS08910 - 1871268..1871885 (-) 618 WP_238990538.1 MBL fold metallo-hydrolase -
  JQC88_RS08915 - 1871966..1872889 (-) 924 WP_203262996.1 recombinase RecT -
  JQC88_RS08920 - 1872891..1874843 (-) 1953 WP_203262997.1 AAA family ATPase -
  JQC88_RS08925 - 1874905..1875081 (-) 177 WP_203262998.1 hypothetical protein -
  JQC88_RS08930 - 1875195..1875437 (+) 243 WP_203262999.1 hypothetical protein -
  JQC88_RS08935 - 1875574..1875783 (-) 210 WP_001830281.1 hypothetical protein -
  JQC88_RS08940 - 1875796..1876536 (-) 741 WP_203263001.1 BRO family protein -
  JQC88_RS08945 - 1876594..1876779 (+) 186 WP_203263003.1 hypothetical protein -
  JQC88_RS08950 - 1876927..1877174 (-) 248 Protein_1737 helix-turn-helix transcriptional regulator -
  JQC88_RS08955 - 1877337..1877660 (+) 324 WP_203263004.1 helix-turn-helix transcriptional regulator -
  JQC88_RS08960 - 1877672..1878133 (+) 462 WP_203263005.1 ImmA/IrrE family metallo-endopeptidase -
  JQC88_RS08965 - 1878150..1878668 (+) 519 WP_203263006.1 hypothetical protein -
  JQC88_RS08970 - 1878670..1879563 (+) 894 WP_238990535.1 DUF5067 domain-containing protein -
  JQC88_RS08975 - 1879652..1880089 (+) 438 WP_099800570.1 DUF4231 domain-containing protein -
  JQC88_RS08980 - 1880083..1880490 (+) 408 WP_099800569.1 TIR domain-containing protein -
  JQC88_RS08985 - 1880487..1880684 (-) 198 WP_002497576.1 hypothetical protein -
  JQC88_RS08990 - 1880796..1881845 (+) 1050 WP_134299676.1 site-specific integrase -

Sequence

Protein


Download         Length: 157 a.a.        Molecular weight: 17654.35 Da        Isoelectric Point: 4.7621

>NTDB_id=533035 JQC88_RS08905 WP_203262994.1 1870794..1871267(-) (ssbA) [Staphylococcus epidermidis strain Z0118SE0269]
MINRVVLVGRLTKDPEFRTTPNGVEVTNFTLAINRNFTNAQGEREADFINVITFRKQAVNVNDYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNANGSQQNDYYQQQSRAQQGQNRQQSNEPVGDNPFANANGPIDISDDDLPF

Nucleotide


Download         Length: 474 bp        

>NTDB_id=533035 JQC88_RS08905 WP_203262994.1 1870794..1871267(-) (ssbA) [Staphylococcus epidermidis strain Z0118SE0269]
ATGATTAATAGAGTTGTATTAGTAGGTAGATTGACAAAGGATCCAGAGTTTAGAACAACTCCTAACGGTGTTGAAGTAAC
AAACTTCACACTAGCGATTAATCGTAATTTTACGAACGCACAAGGCGAACGTGAAGCAGATTTTATAAACGTTATAACTT
TCAGAAAGCAAGCTGTAAACGTAAATGATTATTTATCTAAAGGAAAACTAGCAGGCGTTGATGGACGAATTCAATCACGC
AGCTATGAAAATCAAGAAGGTCGTCGGATTTTTGTCACTGAAGTTGTCGCAGATAGTGTTCAATTTCTCGAACCTAAAAA
TGCAAATGGTAGTCAACAAAATGATTACTACCAACAACAATCAAGAGCTCAGCAAGGACAAAACAGACAACAAAGCAATG
AACCGGTTGGAGATAACCCGTTTGCAAACGCTAATGGTCCAATTGATATTAGTGATGATGATTTACCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

59.302

100

0.65
  ssb Latilactobacillus sakei subsp. sakei 23K

50

100

0.541
  ssbB Bacillus subtilis subsp. subtilis str. 168

57.547

67.516

0.389
  ssb Neisseria meningitidis MC58

34.104

100

0.376
  ssb Neisseria gonorrhoeae MS11

34.104

100

0.376