Detailed information
Overview
| Name | ssbA | Type | Machinery gene |
| Locus tag | JQC88_RS08905 | Genome accession | NZ_CP069215 |
| Coordinates | 1870794..1871267 (-) | Length | 157 a.a. |
| NCBI ID | WP_203262994.1 | Uniprot ID | - |
| Organism | Staphylococcus epidermidis strain Z0118SE0269 | ||
| Function | ssDNA binding (predicted from homology) DNA processing |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 1836552..1881845 | 1870794..1871267 | within | 0 |
Gene organization within MGE regions
Location: 1836552..1881845
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JQC88_RS08665 | - | 1836552..1836893 (-) | 342 | WP_002456621.1 | fatty acid desaturase | - |
| JQC88_RS08670 | - | 1837106..1837342 (-) | 237 | WP_001829451.1 | hypothetical protein | - |
| JQC88_RS12440 | - | 1837544..1837795 (-) | 252 | WP_001829448.1 | plasmid recombination protein | - |
| JQC88_RS12445 | - | 1837877..1838104 (-) | 228 | WP_080033396.1 | plasmid recombination protein | - |
| JQC88_RS08685 | - | 1839149..1840552 (-) | 1404 | WP_103433372.1 | N-acetylmuramoyl-L-alanine amidase | - |
| JQC88_RS08690 | - | 1840552..1840821 (-) | 270 | WP_002469117.1 | phage holin | - |
| JQC88_RS08695 | - | 1840877..1841404 (-) | 528 | WP_001830238.1 | hypothetical protein | - |
| JQC88_RS08700 | - | 1841404..1841913 (-) | 510 | WP_012099596.1 | hypothetical protein | - |
| JQC88_RS08705 | - | 1841966..1843888 (-) | 1923 | WP_203262960.1 | glucosaminidase domain-containing protein | - |
| JQC88_RS08710 | - | 1844023..1844322 (-) | 300 | WP_064604136.1 | DUF2951 family protein | - |
| JQC88_RS08715 | - | 1844361..1844498 (-) | 138 | WP_107514072.1 | XkdX family protein | - |
| JQC88_RS08720 | - | 1844491..1844826 (-) | 336 | WP_064604133.1 | hypothetical protein | - |
| JQC88_RS08725 | - | 1844831..1846372 (-) | 1542 | WP_203262962.1 | BppU family phage baseplate upper protein | - |
| JQC88_RS08730 | - | 1846372..1849038 (-) | 2667 | WP_203262963.1 | peptidase G2 autoproteolytic cleavage domain-containing protein | - |
| JQC88_RS08735 | - | 1849053..1850924 (-) | 1872 | WP_203262964.1 | SGNH/GDSL hydrolase family protein | - |
| JQC88_RS08740 | - | 1850933..1851880 (-) | 948 | WP_203262965.1 | phage tail domain-containing protein | - |
| JQC88_RS08745 | - | 1851892..1855665 (-) | 3774 | WP_203262966.1 | phage tail protein | - |
| JQC88_RS08750 | - | 1855682..1856026 (-) | 345 | WP_064604115.1 | hypothetical protein | - |
| JQC88_RS08755 | - | 1856074..1856442 (-) | 369 | WP_099800300.1 | tail assembly chaperone | - |
| JQC88_RS08760 | - | 1856501..1857055 (-) | 555 | WP_107519414.1 | phage major tail protein, TP901-1 family | - |
| JQC88_RS08765 | - | 1857111..1857497 (-) | 387 | WP_107514080.1 | hypothetical protein | - |
| JQC88_RS08770 | - | 1857509..1857859 (-) | 351 | WP_203262967.1 | HK97-gp10 family putative phage morphogenesis protein | - |
| JQC88_RS08775 | - | 1857859..1858161 (-) | 303 | WP_203262968.1 | hypothetical protein | - |
| JQC88_RS08780 | - | 1858158..1858487 (-) | 330 | WP_064604097.1 | phage head-tail connector protein | - |
| JQC88_RS08785 | - | 1858489..1858758 (-) | 270 | WP_203262969.1 | hypothetical protein | - |
| JQC88_RS08790 | - | 1858774..1859706 (-) | 933 | WP_203262970.1 | phage major capsid protein | - |
| JQC88_RS08795 | - | 1859722..1860333 (-) | 612 | WP_203262971.1 | DUF4355 domain-containing protein | - |
| JQC88_RS08800 | - | 1860508..1860651 (-) | 144 | WP_203262973.1 | hypothetical protein | - |
| JQC88_RS08805 | - | 1860648..1861598 (-) | 951 | WP_203262976.1 | minor capsid protein | - |
| JQC88_RS08810 | - | 1861605..1863122 (-) | 1518 | WP_203262978.1 | phage portal protein | - |
| JQC88_RS08815 | - | 1863133..1864413 (-) | 1281 | WP_203262979.1 | PBSX family phage terminase large subunit | - |
| JQC88_RS08820 | - | 1864400..1864897 (-) | 498 | WP_099800266.1 | terminase small subunit | - |
| JQC88_RS08825 | - | 1865068..1865334 (-) | 267 | WP_203262980.1 | hypothetical protein | - |
| JQC88_RS08830 | - | 1865345..1865764 (-) | 420 | WP_061827622.1 | transcriptional regulator | - |
| JQC88_RS08835 | - | 1865767..1865907 (-) | 141 | WP_002470855.1 | hypothetical protein | - |
| JQC88_RS08840 | - | 1865895..1866293 (-) | 399 | WP_002468964.1 | hypothetical protein | - |
| JQC88_RS08845 | - | 1866295..1866465 (-) | 171 | WP_203262981.1 | transcriptional regulator | - |
| JQC88_RS08850 | - | 1866458..1866778 (-) | 321 | WP_203262982.1 | hypothetical protein | - |
| JQC88_RS08855 | - | 1866784..1866996 (-) | 213 | WP_203262983.1 | DUF1381 domain-containing protein | - |
| JQC88_RS08860 | - | 1867009..1867173 (-) | 165 | WP_203262984.1 | hypothetical protein | - |
| JQC88_RS08865 | - | 1867210..1867737 (-) | 528 | WP_203262985.1 | dUTP pyrophosphatase | - |
| JQC88_RS08870 | - | 1867730..1867909 (-) | 180 | WP_203262986.1 | DUF1024 family protein | - |
| JQC88_RS08875 | - | 1867899..1868147 (-) | 249 | WP_203262987.1 | hypothetical protein | - |
| JQC88_RS08880 | - | 1868137..1868424 (-) | 288 | WP_203262988.1 | hypothetical protein | - |
| JQC88_RS12350 | - | 1868421..1868624 (-) | 204 | WP_238990533.1 | hypothetical protein | - |
| JQC88_RS08885 | - | 1868614..1869066 (-) | 453 | WP_203262990.1 | DUF3310 domain-containing protein | - |
| JQC88_RS08890 | - | 1869066..1869422 (-) | 357 | WP_203262991.1 | SA1788 family PVL leukocidin-associated protein | - |
| JQC88_RS08895 | - | 1869423..1869830 (-) | 408 | WP_203262992.1 | RusA family crossover junction endodeoxyribonuclease | - |
| JQC88_RS08900 | - | 1869868..1870764 (-) | 897 | WP_203262993.1 | DnaD domain protein | - |
| JQC88_RS08905 | ssbA | 1870794..1871267 (-) | 474 | WP_203262994.1 | single-stranded DNA-binding protein | Machinery gene |
| JQC88_RS08910 | - | 1871268..1871885 (-) | 618 | WP_238990538.1 | MBL fold metallo-hydrolase | - |
| JQC88_RS08915 | - | 1871966..1872889 (-) | 924 | WP_203262996.1 | recombinase RecT | - |
| JQC88_RS08920 | - | 1872891..1874843 (-) | 1953 | WP_203262997.1 | AAA family ATPase | - |
| JQC88_RS08925 | - | 1874905..1875081 (-) | 177 | WP_203262998.1 | hypothetical protein | - |
| JQC88_RS08930 | - | 1875195..1875437 (+) | 243 | WP_203262999.1 | hypothetical protein | - |
| JQC88_RS08935 | - | 1875574..1875783 (-) | 210 | WP_001830281.1 | hypothetical protein | - |
| JQC88_RS08940 | - | 1875796..1876536 (-) | 741 | WP_203263001.1 | BRO family protein | - |
| JQC88_RS08945 | - | 1876594..1876779 (+) | 186 | WP_203263003.1 | hypothetical protein | - |
| JQC88_RS08950 | - | 1876927..1877174 (-) | 248 | Protein_1737 | helix-turn-helix transcriptional regulator | - |
| JQC88_RS08955 | - | 1877337..1877660 (+) | 324 | WP_203263004.1 | helix-turn-helix transcriptional regulator | - |
| JQC88_RS08960 | - | 1877672..1878133 (+) | 462 | WP_203263005.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JQC88_RS08965 | - | 1878150..1878668 (+) | 519 | WP_203263006.1 | hypothetical protein | - |
| JQC88_RS08970 | - | 1878670..1879563 (+) | 894 | WP_238990535.1 | DUF5067 domain-containing protein | - |
| JQC88_RS08975 | - | 1879652..1880089 (+) | 438 | WP_099800570.1 | DUF4231 domain-containing protein | - |
| JQC88_RS08980 | - | 1880083..1880490 (+) | 408 | WP_099800569.1 | TIR domain-containing protein | - |
| JQC88_RS08985 | - | 1880487..1880684 (-) | 198 | WP_002497576.1 | hypothetical protein | - |
| JQC88_RS08990 | - | 1880796..1881845 (+) | 1050 | WP_134299676.1 | site-specific integrase | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17654.35 Da Isoelectric Point: 4.7621
>NTDB_id=533035 JQC88_RS08905 WP_203262994.1 1870794..1871267(-) (ssbA) [Staphylococcus epidermidis strain Z0118SE0269]
MINRVVLVGRLTKDPEFRTTPNGVEVTNFTLAINRNFTNAQGEREADFINVITFRKQAVNVNDYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNANGSQQNDYYQQQSRAQQGQNRQQSNEPVGDNPFANANGPIDISDDDLPF
MINRVVLVGRLTKDPEFRTTPNGVEVTNFTLAINRNFTNAQGEREADFINVITFRKQAVNVNDYLSKGKLAGVDGRIQSR
SYENQEGRRIFVTEVVADSVQFLEPKNANGSQQNDYYQQQSRAQQGQNRQQSNEPVGDNPFANANGPIDISDDDLPF
Nucleotide
Download Length: 474 bp
>NTDB_id=533035 JQC88_RS08905 WP_203262994.1 1870794..1871267(-) (ssbA) [Staphylococcus epidermidis strain Z0118SE0269]
ATGATTAATAGAGTTGTATTAGTAGGTAGATTGACAAAGGATCCAGAGTTTAGAACAACTCCTAACGGTGTTGAAGTAAC
AAACTTCACACTAGCGATTAATCGTAATTTTACGAACGCACAAGGCGAACGTGAAGCAGATTTTATAAACGTTATAACTT
TCAGAAAGCAAGCTGTAAACGTAAATGATTATTTATCTAAAGGAAAACTAGCAGGCGTTGATGGACGAATTCAATCACGC
AGCTATGAAAATCAAGAAGGTCGTCGGATTTTTGTCACTGAAGTTGTCGCAGATAGTGTTCAATTTCTCGAACCTAAAAA
TGCAAATGGTAGTCAACAAAATGATTACTACCAACAACAATCAAGAGCTCAGCAAGGACAAAACAGACAACAAAGCAATG
AACCGGTTGGAGATAACCCGTTTGCAAACGCTAATGGTCCAATTGATATTAGTGATGATGATTTACCATTTTAA
ATGATTAATAGAGTTGTATTAGTAGGTAGATTGACAAAGGATCCAGAGTTTAGAACAACTCCTAACGGTGTTGAAGTAAC
AAACTTCACACTAGCGATTAATCGTAATTTTACGAACGCACAAGGCGAACGTGAAGCAGATTTTATAAACGTTATAACTT
TCAGAAAGCAAGCTGTAAACGTAAATGATTATTTATCTAAAGGAAAACTAGCAGGCGTTGATGGACGAATTCAATCACGC
AGCTATGAAAATCAAGAAGGTCGTCGGATTTTTGTCACTGAAGTTGTCGCAGATAGTGTTCAATTTCTCGAACCTAAAAA
TGCAAATGGTAGTCAACAAAATGATTACTACCAACAACAATCAAGAGCTCAGCAAGGACAAAACAGACAACAAAGCAATG
AACCGGTTGGAGATAACCCGTTTGCAAACGCTAATGGTCCAATTGATATTAGTGATGATGATTTACCATTTTAA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| ssbA | Bacillus subtilis subsp. subtilis str. 168 |
59.302 |
100 |
0.65 |
| ssb | Latilactobacillus sakei subsp. sakei 23K |
50 |
100 |
0.541 |
| ssbB | Bacillus subtilis subsp. subtilis str. 168 |
57.547 |
67.516 |
0.389 |
| ssb | Neisseria meningitidis MC58 |
34.104 |
100 |
0.376 |
| ssb | Neisseria gonorrhoeae MS11 |
34.104 |
100 |
0.376 |