Detailed information
Bioinformatically predicted
Overview
| Name | prx | Type | Regulator |
| Locus tag | JOA01_RS03300 | Genome accession | NZ_CP069079 |
| Coordinates | 637775..638005 (+) | Length | 76 a.a. |
| NCBI ID | WP_217374877.1 | Uniprot ID | - |
| Organism | Streptococcus parasuis strain BS26 | ||
| Function | Inhibit ComR activation (predicted from homology) Competence regulation |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 603438..649484 | 637775..638005 | within | 0 |
Gene organization within MGE regions
Location: 603438..649484
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JOA01_RS03075 (JOA01_03080) | - | 603495..605234 (+) | 1740 | WP_217374837.1 | ABC transporter ATP-binding protein | - |
| JOA01_RS03080 (JOA01_03085) | - | 605224..606969 (+) | 1746 | WP_217374838.1 | ABC transporter ATP-binding protein | - |
| JOA01_RS03085 (JOA01_03090) | - | 607003..607677 (+) | 675 | WP_217375147.1 | hydrolase | - |
| JOA01_RS03095 (JOA01_03100) | - | 607876..608937 (-) | 1062 | WP_217374839.1 | site-specific integrase | - |
| JOA01_RS03100 (JOA01_03105) | - | 609070..609846 (-) | 777 | WP_217374840.1 | hypothetical protein | - |
| JOA01_RS03105 (JOA01_03110) | - | 609904..610287 (-) | 384 | WP_217374841.1 | ImmA/IrrE family metallo-endopeptidase | - |
| JOA01_RS03110 (JOA01_03115) | - | 610295..610648 (-) | 354 | WP_217374842.1 | helix-turn-helix domain-containing protein | - |
| JOA01_RS03115 (JOA01_03120) | - | 610937..611149 (+) | 213 | WP_217374843.1 | transcriptional regulator | - |
| JOA01_RS03120 (JOA01_03125) | - | 611163..611870 (+) | 708 | WP_217374844.1 | ORF6C domain-containing protein | - |
| JOA01_RS03125 (JOA01_03130) | - | 611935..612207 (+) | 273 | WP_024412308.1 | hypothetical protein | - |
| JOA01_RS03130 (JOA01_03135) | - | 612217..612405 (+) | 189 | WP_217374845.1 | hypothetical protein | - |
| JOA01_RS03135 (JOA01_03140) | - | 612407..612637 (+) | 231 | WP_217374846.1 | hypothetical protein | - |
| JOA01_RS03140 (JOA01_03145) | - | 612640..612816 (+) | 177 | WP_217374847.1 | hypothetical protein | - |
| JOA01_RS03145 (JOA01_03150) | dnaB | 612788..614119 (+) | 1332 | WP_217374848.1 | replicative DNA helicase | - |
| JOA01_RS03150 (JOA01_03155) | - | 614122..614886 (+) | 765 | WP_217374849.1 | conserved phage C-terminal domain-containing protein | - |
| JOA01_RS03155 (JOA01_03160) | - | 614887..615708 (+) | 822 | WP_217374850.1 | ATP-binding protein | - |
| JOA01_RS03160 (JOA01_03165) | - | 615708..615935 (+) | 228 | WP_217374851.1 | hypothetical protein | - |
| JOA01_RS03165 (JOA01_03170) | - | 615961..616344 (+) | 384 | WP_217374852.1 | hypothetical protein | - |
| JOA01_RS03170 (JOA01_03175) | - | 616341..616508 (+) | 168 | WP_217374853.1 | hypothetical protein | - |
| JOA01_RS03175 (JOA01_03180) | - | 616517..616738 (+) | 222 | WP_217374854.1 | hypothetical protein | - |
| JOA01_RS03180 (JOA01_03185) | - | 616716..617180 (+) | 465 | WP_217374855.1 | hypothetical protein | - |
| JOA01_RS03185 (JOA01_03190) | - | 617290..617832 (+) | 543 | WP_001028147.1 | site-specific integrase | - |
| JOA01_RS03190 (JOA01_03195) | - | 618385..618621 (+) | 237 | WP_254451657.1 | HNH endonuclease | - |
| JOA01_RS03195 (JOA01_03200) | - | 618709..619194 (+) | 486 | WP_217374857.1 | hypothetical protein | - |
| JOA01_RS03200 (JOA01_03205) | - | 619187..620899 (+) | 1713 | WP_217374858.1 | terminase TerL endonuclease subunit | - |
| JOA01_RS03205 (JOA01_03210) | - | 620908..622050 (+) | 1143 | WP_217374859.1 | phage portal protein | - |
| JOA01_RS03210 (JOA01_03215) | - | 622101..622643 (+) | 543 | WP_217374860.1 | HK97 family phage prohead protease | - |
| JOA01_RS03215 (JOA01_03220) | - | 622654..623916 (+) | 1263 | WP_217375148.1 | phage major capsid protein | - |
| JOA01_RS03220 (JOA01_03225) | - | 623935..624270 (+) | 336 | WP_217374861.1 | hypothetical protein | - |
| JOA01_RS03225 (JOA01_03230) | - | 624267..624572 (+) | 306 | WP_217374862.1 | head-tail adaptor protein | - |
| JOA01_RS03230 (JOA01_03235) | - | 624572..624919 (+) | 348 | WP_217374863.1 | hypothetical protein | - |
| JOA01_RS03235 (JOA01_03240) | - | 624906..625250 (+) | 345 | WP_217374864.1 | HK97 gp10 family phage protein | - |
| JOA01_RS03240 (JOA01_03245) | - | 625265..625948 (+) | 684 | WP_217374865.1 | phage tail protein | - |
| JOA01_RS03245 (JOA01_03250) | - | 625948..626412 (+) | 465 | WP_217374866.1 | hypothetical protein | - |
| JOA01_RS03250 (JOA01_03255) | - | 626609..629074 (+) | 2466 | WP_217374867.1 | phage tail tape measure protein | - |
| JOA01_RS03255 (JOA01_03260) | - | 629080..629802 (+) | 723 | WP_217374868.1 | phage tail protein | - |
| JOA01_RS03260 (JOA01_03265) | - | 629803..633942 (+) | 4140 | WP_217374869.1 | phage tail spike protein | - |
| JOA01_RS03265 (JOA01_03270) | - | 633956..634384 (+) | 429 | WP_217374870.1 | DUF1617 family protein | - |
| JOA01_RS03270 (JOA01_03275) | - | 634387..634725 (+) | 339 | WP_217374871.1 | hypothetical protein | - |
| JOA01_RS03275 (JOA01_03280) | - | 634729..635064 (+) | 336 | WP_217374872.1 | hypothetical protein | - |
| JOA01_RS03280 (JOA01_03285) | - | 635075..635404 (+) | 330 | WP_217374873.1 | phage holin | - |
| JOA01_RS03285 (JOA01_03290) | - | 635407..636807 (+) | 1401 | WP_217374874.1 | peptidoglycan amidohydrolase family protein | - |
| JOA01_RS03290 (JOA01_03295) | - | 636998..637291 (+) | 294 | WP_217374875.1 | hypothetical protein | - |
| JOA01_RS03295 (JOA01_03300) | - | 637288..637710 (+) | 423 | WP_217374876.1 | hypothetical protein | - |
| JOA01_RS03300 (JOA01_03305) | prx | 637775..638005 (+) | 231 | WP_217374877.1 | Paratox | Regulator |
| JOA01_RS03305 (JOA01_03310) | - | 638140..638970 (-) | 831 | WP_254451635.1 | site-specific integrase | - |
| JOA01_RS03310 (JOA01_03315) | - | 639108..639434 (-) | 327 | WP_217375212.1 | hypothetical protein | - |
| JOA01_RS09905 | - | 639436..639585 (-) | 150 | WP_254451636.1 | hypothetical protein | - |
| JOA01_RS09910 | - | 639610..639822 (-) | 213 | WP_254451637.1 | hypothetical protein | - |
| JOA01_RS03320 (JOA01_03325) | - | 639765..639953 (+) | 189 | Protein_622 | PTS system mannose/fructose/sorbose family transporter subunit IID | - |
| JOA01_RS03325 (JOA01_03330) | - | 639988..640248 (+) | 261 | WP_217374878.1 | hypothetical protein | - |
| JOA01_RS03330 (JOA01_03335) | - | 640451..641635 (-) | 1185 | WP_217374879.1 | chloride channel protein | - |
| JOA01_RS03335 (JOA01_03340) | - | 641628..641903 (-) | 276 | WP_217374880.1 | chorismate mutase | - |
| JOA01_RS03340 (JOA01_03345) | rpsN | 641985..642215 (-) | 231 | WP_254451638.1 | 30S ribosomal protein S14 | - |
| JOA01_RS03345 (JOA01_03350) | - | 642392..642853 (-) | 462 | WP_217374881.1 | flavodoxin | - |
| JOA01_RS03350 (JOA01_03355) | - | 642948..643892 (+) | 945 | WP_217374882.1 | bifunctional oligoribonuclease/PAP phosphatase NrnA | - |
| JOA01_RS03355 (JOA01_03360) | - | 643879..644907 (+) | 1029 | WP_217374883.1 | FAD:protein FMN transferase | - |
| JOA01_RS03360 (JOA01_03365) | - | 645047..645289 (+) | 243 | WP_172036431.1 | type B 50S ribosomal protein L31 | - |
| JOA01_RS03365 (JOA01_03370) | - | 645621..646859 (+) | 1239 | WP_217374884.1 | FtsW/RodA/SpoVE family cell cycle protein | - |
| JOA01_RS03370 (JOA01_03375) | - | 646867..647409 (+) | 543 | WP_217374885.1 | DJ-1 family glyoxalase III | - |
| JOA01_RS03375 (JOA01_03380) | gyrB | 647532..649484 (+) | 1953 | WP_217374886.1 | DNA topoisomerase (ATP-hydrolyzing) subunit B | - |
Sequence
Protein
Download Length: 76 a.a. Molecular weight: 8867.43 Da Isoelectric Point: 9.6542
>NTDB_id=532169 JOA01_RS03300 WP_217374877.1 637775..638005(+) (prx) [Streptococcus parasuis strain BS26]
MLEYSELKQAVDNGFIQGDKVMIVRRDGKIFDYVLSGEPVRPWEIVSEERVVDVMRELKKTLSKICPKCPKNARKR
MLEYSELKQAVDNGFIQGDKVMIVRRDGKIFDYVLSGEPVRPWEIVSEERVVDVMRELKKTLSKICPKCPKNARKR
Nucleotide
Download Length: 231 bp
>NTDB_id=532169 JOA01_RS03300 WP_217374877.1 637775..638005(+) (prx) [Streptococcus parasuis strain BS26]
ATGTTAGAATACAGCGAACTAAAACAAGCAGTAGATAATGGATTTATCCAAGGCGACAAGGTGATGATAGTCCGCAGGGA
CGGTAAGATATTTGATTATGTTTTATCTGGTGAGCCAGTCAGACCATGGGAGATTGTGAGCGAGGAGCGGGTAGTGGATG
TGATGAGGGAATTAAAAAAGACCTTGTCCAAAATTTGTCCAAAATGTCCAAAAAATGCTAGGAAAAGATAA
ATGTTAGAATACAGCGAACTAAAACAAGCAGTAGATAATGGATTTATCCAAGGCGACAAGGTGATGATAGTCCGCAGGGA
CGGTAAGATATTTGATTATGTTTTATCTGGTGAGCCAGTCAGACCATGGGAGATTGTGAGCGAGGAGCGGGTAGTGGATG
TGATGAGGGAATTAAAAAAGACCTTGTCCAAAATTTGTCCAAAATGTCCAAAAAATGCTAGGAAAAGATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| prx | Streptococcus pyogenes MGAS315 |
63.333 |
78.947 |
0.5 |
| prx | Streptococcus pyogenes MGAS8232 |
56.667 |
78.947 |
0.447 |
| prx | Streptococcus pyogenes MGAS315 |
56.667 |
78.947 |
0.447 |
| prx | Streptococcus pyogenes MGAS315 |
53.333 |
78.947 |
0.421 |
| prx | Streptococcus pyogenes MGAS315 |
69.048 |
55.263 |
0.382 |