Detailed information
Overview
| Name | comGA | Type | Machinery gene |
| Locus tag | LLUC073_RS11785 | Genome accession | NZ_CP068698 |
| Coordinates | 2272099..2272290 (-) | Length | 63 a.a. |
| NCBI ID | WP_282671404.1 | Uniprot ID | - |
| Organism | Lactococcus cremoris strain UC073 | ||
| Function | dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 2263059..2271160 | 2272099..2272290 | flank | 939 |
| IS/Tn | 2271227..2272117 | 2272099..2272290 | flank | -18 |
Gene organization within MGE regions
Location: 2263059..2272290
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLUC073_RS11725 (LLUC073_11460) | - | 2264519..2265328 (-) | 810 | WP_011677177.1 | metal ABC transporter permease | - |
| LLUC073_RS11730 (LLUC073_11465) | - | 2265321..2266058 (-) | 738 | WP_011677178.1 | metal ABC transporter ATP-binding protein | - |
| LLUC073_RS11735 (LLUC073_11470) | - | 2266237..2267079 (-) | 843 | WP_011677179.1 | metal ABC transporter solute-binding protein, Zn/Mn family | - |
| LLUC073_RS11740 (LLUC073_11475) | - | 2267076..2267513 (-) | 438 | WP_282670666.1 | zinc-dependent MarR family transcriptional regulator | - |
| LLUC073_RS11745 (LLUC073_11480) | comGG | 2267593..2267892 (-) | 300 | WP_282670667.1 | competence type IV pilus minor pilin ComGG | Machinery gene |
| LLUC073_RS11750 (LLUC073_11485) | comGF | 2267916..2268341 (-) | 426 | WP_014735174.1 | competence type IV pilus minor pilin ComGF | Machinery gene |
| LLUC073_RS11755 (LLUC073_11490) | comGE | 2268325..2268561 (-) | 237 | WP_014573335.1 | competence type IV pilus minor pilin ComGE | Machinery gene |
| LLUC073_RS11760 (LLUC073_14140) | comGD | 2268593..2268781 (-) | 189 | WP_014573336.1 | hypothetical protein | Machinery gene |
| LLUC073_RS11765 (LLUC073_11500) | comGC | 2268983..2269333 (-) | 351 | WP_050574401.1 | competence type IV pilus major pilin ComGC | Machinery gene |
| LLUC073_RS11770 (LLUC073_11505) | comGB | 2269378..2270403 (-) | 1026 | WP_050574400.1 | competence type IV pilus assembly protein ComGB | Machinery gene |
| LLUC073_RS11775 (LLUC073_11510) | comGA | 2270303..2271160 (-) | 858 | WP_318299077.1 | ATPase, T2SS/T4P/T4SS family | Machinery gene |
| LLUC073_RS11780 (LLUC073_11515) | - | 2271227..2272117 (+) | 891 | WP_014572485.1 | IS982-like element IS982B family transposase | - |
| LLUC073_RS11785 (LLUC073_11520) | comGA | 2272099..2272290 (-) | 192 | WP_282671404.1 | hypothetical protein | Machinery gene |
Sequence
Protein
Download Length: 63 a.a. Molecular weight: 7303.60 Da Isoelectric Point: 4.5822
>NTDB_id=530497 LLUC073_RS11785 WP_282671404.1 2272099..2272290(-) (comGA) [Lactococcus cremoris strain UC073]
MVQKKAQELIQKAIEMEASDIYLIASGNLYKIYIRQQLGRTLIEELNQEIGLPELLVYYLAMT
MVQKKAQELIQKAIEMEASDIYLIASGNLYKIYIRQQLGRTLIEELNQEIGLPELLVYYLAMT
Nucleotide
Download Length: 192 bp
>NTDB_id=530497 LLUC073_RS11785 WP_282671404.1 2272099..2272290(-) (comGA) [Lactococcus cremoris strain UC073]
ATGGTACAGAAAAAAGCACAAGAACTCATTCAAAAGGCAATTGAGATGGAGGCTTCTGATATTTATTTAATTGCTTCAGG
AAATCTTTATAAGATATATATTCGTCAACAATTAGGGCGAACTTTAATAGAGGAACTTAACCAAGAGATTGGTTTACCCG
AATTGCTAGTTTATTATTTAGCCATGACTTGA
ATGGTACAGAAAAAAGCACAAGAACTCATTCAAAAGGCAATTGAGATGGAGGCTTCTGATATTTATTTAATTGCTTCAGG
AAATCTTTATAAGATATATATTCGTCAACAATTAGGGCGAACTTTAATAGAGGAACTTAACCAAGAGATTGGTTTACCCG
AATTGCTAGTTTATTATTTAGCCATGACTTGA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comGA | Lactococcus lactis subsp. cremoris KW2 |
89.831 |
93.651 |
0.841 |