Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   JG554_RS09205 Genome accession   NZ_CP068241
Coordinates   1925177..1925617 (-) Length   146 a.a.
NCBI ID   WP_203265261.1    Uniprot ID   -
Organism   Staphylococcus sp. 11-B-312     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1883638..1932331 1925177..1925617 within 0


Gene organization within MGE regions


Location: 1883638..1932331
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JG554_RS08945 (JG554_08945) - 1883638..1884084 (-) 447 Protein_1734 SH3 domain-containing protein -
  JG554_RS08950 (JG554_08950) - 1884185..1885356 (+) 1172 Protein_1735 IS256-like element IS256 family transposase -
  JG554_RS08955 (JG554_08955) - 1885413..1885805 (+) 393 WP_000393259.1 GNAT family N-acetyltransferase -
  JG554_RS08960 (JG554_08960) aph(2'')-Ia 1885806..1887245 (+) 1440 WP_001028144.1 aminoglycoside O-phosphotransferase APH(2'')-Ia -
  JG554_RS08965 (JG554_08965) - 1887374..1888546 (-) 1173 WP_000195429.1 IS256-like element IS256 family transposase -
  JG554_RS08970 (JG554_08970) - 1888651..1889559 (-) 909 Protein_1739 N-acetylmuramoyl-L-alanine amidase -
  JG554_RS08975 (JG554_08975) - 1889675..1890361 (-) 687 WP_192948081.1 AP2 domain-containing protein -
  JG554_RS08980 (JG554_08980) - 1890655..1891128 (-) 474 WP_107520603.1 phage holin -
  JG554_RS08985 (JG554_08985) - 1891276..1891767 (-) 492 WP_107520604.1 hypothetical protein -
  JG554_RS08990 (JG554_08990) - 1891772..1892863 (-) 1092 WP_203265233.1 S8 family serine peptidase -
  JG554_RS08995 (JG554_08995) - 1892860..1893594 (-) 735 WP_203265234.1 BppU family phage baseplate upper protein -
  JG554_RS09000 (JG554_09000) - 1893642..1894040 (-) 399 WP_203265235.1 hypothetical protein -
  JG554_RS09005 (JG554_09005) - 1894027..1894449 (-) 423 WP_203265236.1 hypothetical protein -
  JG554_RS09010 (JG554_09010) - 1894486..1894977 (-) 492 WP_238394757.1 XkdX family protein -
  JG554_RS09015 (JG554_09015) - 1894977..1896647 (-) 1671 WP_203265237.1 phage baseplate upper protein -
  JG554_RS09020 (JG554_09020) - 1896661..1898373 (-) 1713 WP_203265238.1 phosphodiester glycosidase family protein -
  JG554_RS09025 (JG554_09025) - 1898388..1898906 (-) 519 WP_203265239.1 hypothetical protein -
  JG554_RS09030 (JG554_09030) - 1898899..1900452 (-) 1554 WP_203265240.1 prophage endopeptidase tail family protein -
  JG554_RS09035 (JG554_09035) - 1900462..1901289 (-) 828 WP_203265241.1 phage tail domain-containing protein -
  JG554_RS09040 (JG554_09040) - 1901291..1906846 (-) 5556 WP_203265242.1 peptidoglycan DD-metalloendopeptidase family protein -
  JG554_RS13200 - 1906885..1907085 (-) 201 WP_073342768.1 hypothetical protein -
  JG554_RS09045 (JG554_09045) - 1907127..1907453 (-) 327 WP_103161283.1 hypothetical protein -
  JG554_RS09050 (JG554_09050) - 1907558..1908178 (-) 621 WP_203265243.1 major tail protein -
  JG554_RS09055 (JG554_09055) - 1908241..1908642 (-) 402 WP_238394758.1 hypothetical protein -
  JG554_RS09060 (JG554_09060) - 1908651..1909046 (-) 396 WP_203265244.1 hypothetical protein -
  JG554_RS09065 (JG554_09065) - 1909043..1909393 (-) 351 WP_203265245.1 phage head-tail adapter protein -
  JG554_RS09070 (JG554_09070) - 1909377..1909664 (-) 288 WP_203265246.1 hypothetical protein -
  JG554_RS09075 (JG554_09075) - 1909670..1909840 (-) 171 WP_186297065.1 hypothetical protein -
  JG554_RS09080 (JG554_09080) - 1909857..1911068 (-) 1212 WP_203265247.1 phage major capsid protein -
  JG554_RS09085 (JG554_09085) - 1911092..1911877 (-) 786 WP_203265248.1 head maturation protease, ClpP-related -
  JG554_RS09090 (JG554_09090) - 1911870..1913033 (-) 1164 WP_203265249.1 phage portal protein -
  JG554_RS09095 (JG554_09095) - 1913045..1914676 (-) 1632 WP_238394759.1 terminase TerL endonuclease subunit -
  JG554_RS09100 (JG554_09100) - 1914673..1915029 (-) 357 WP_103161279.1 hypothetical protein -
  JG554_RS09105 (JG554_09105) - 1915201..1915494 (-) 294 WP_203265403.1 HNH endonuclease -
  JG554_RS09110 (JG554_09110) - 1916136..1916531 (-) 396 WP_128088426.1 hypothetical protein -
  JG554_RS09115 (JG554_09115) - 1916545..1916769 (-) 225 WP_128088425.1 DUF1514 family protein -
  JG554_RS09120 (JG554_09120) - 1916769..1917110 (-) 342 WP_203265250.1 hypothetical protein -
  JG554_RS09125 (JG554_09125) - 1917110..1917244 (-) 135 WP_203265251.1 transcriptional regulator -
  JG554_RS09130 (JG554_09130) - 1917241..1917390 (-) 150 WP_203265252.1 DUF1381 domain-containing protein -
  JG554_RS09135 (JG554_09135) dut 1917438..1917860 (-) 423 WP_203265253.1 dUTP diphosphatase -
  JG554_RS09140 (JG554_09140) - 1917861..1918136 (-) 276 WP_203265254.1 hypothetical protein -
  JG554_RS09145 (JG554_09145) dcm 1918336..1919778 (-) 1443 WP_203265255.1 DNA (cytosine-5-)-methyltransferase -
  JG554_RS09150 (JG554_09150) - 1919779..1920522 (-) 744 WP_203265256.1 DUF3310 domain-containing protein -
  JG554_RS09155 (JG554_09155) - 1920523..1920741 (-) 219 WP_203265257.1 hypothetical protein -
  JG554_RS09160 (JG554_09160) - 1920753..1921154 (-) 402 WP_203265258.1 hypothetical protein -
  JG554_RS09165 (JG554_09165) - 1921156..1921344 (-) 189 WP_145381604.1 hypothetical protein -
  JG554_RS09170 (JG554_09170) - 1921350..1921751 (-) 402 WP_192947722.1 DUF1064 domain-containing protein -
  JG554_RS09175 (JG554_09175) - 1921762..1921986 (-) 225 WP_192947723.1 DUF3269 family protein -
  JG554_RS09180 (JG554_09180) - 1921977..1922183 (-) 207 WP_192947724.1 hypothetical protein -
  JG554_RS09185 (JG554_09185) - 1922180..1923415 (-) 1236 WP_192947725.1 DnaB helicase C-terminal domain-containing protein -
  JG554_RS09190 (JG554_09190) - 1923408..1923767 (-) 360 WP_226857833.1 replicative helicase loader/inhibitor -
  JG554_RS09195 (JG554_09195) - 1923777..1924481 (-) 705 WP_203265259.1 helix-turn-helix domain-containing protein -
  JG554_RS09200 (JG554_09200) - 1924468..1925148 (-) 681 WP_203265260.1 putative HNHc nuclease -
  JG554_RS09205 (JG554_09205) ssbA 1925177..1925617 (-) 441 WP_203265261.1 single-stranded DNA-binding protein Machinery gene
  JG554_RS09210 (JG554_09210) - 1925607..1926239 (-) 633 WP_203265262.1 DUF1071 domain-containing protein -
  JG554_RS09215 (JG554_09215) - 1926232..1926492 (-) 261 WP_203265263.1 hypothetical protein -
  JG554_RS09220 (JG554_09220) - 1926554..1926730 (-) 177 WP_203265264.1 hypothetical protein -
  JG554_RS09225 (JG554_09225) - 1926743..1926952 (-) 210 WP_046208793.1 hypothetical protein -
  JG554_RS09230 (JG554_09230) - 1927137..1927370 (-) 234 WP_203265265.1 hypothetical protein -
  JG554_RS09235 (JG554_09235) - 1927425..1927664 (+) 240 WP_203265266.1 hypothetical protein -
  JG554_RS09240 (JG554_09240) - 1927609..1927803 (-) 195 WP_203265267.1 hypothetical protein -
  JG554_RS09245 (JG554_09245) - 1927816..1928568 (-) 753 WP_203265268.1 phage regulatory protein/antirepressor Ant -
  JG554_RS13205 - 1928668..1928910 (+) 243 WP_238394760.1 hypothetical protein -
  JG554_RS09250 (JG554_09250) - 1929057..1929281 (+) 225 WP_203265269.1 hypothetical protein -
  JG554_RS09255 (JG554_09255) - 1929386..1929631 (-) 246 WP_203265270.1 helix-turn-helix transcriptional regulator -
  JG554_RS09260 (JG554_09260) - 1929796..1930122 (+) 327 WP_203265271.1 helix-turn-helix transcriptional regulator -
  JG554_RS09265 (JG554_09265) - 1930134..1930598 (+) 465 WP_203265272.1 ImmA/IrrE family metallo-endopeptidase -
  JG554_RS09270 (JG554_09270) - 1930670..1931221 (+) 552 WP_203265273.1 Ltp family lipoprotein -
  JG554_RS09275 (JG554_09275) - 1931282..1932331 (+) 1050 WP_203265274.1 site-specific integrase -

Sequence

Protein


Download         Length: 146 a.a.        Molecular weight: 16281.08 Da        Isoelectric Point: 5.8947

>NTDB_id=528496 JG554_RS09205 WP_203265261.1 1925177..1925617(-) (ssbA) [Staphylococcus sp. 11-B-312]
MINRFIGVGRLTKDPNFVEGQTAIANFTIACNRPFKNKNGEQDADFINVVTFRKQAENVNNYVHKGDMVGIDGRIQTRSY
ENKEGKRIFVTEVVADSVQFMEPKSQSKGQSQQQSGQAKPQQQPVSDNPFANANGPIDISDDDLPF

Nucleotide


Download         Length: 441 bp        

>NTDB_id=528496 JG554_RS09205 WP_203265261.1 1925177..1925617(-) (ssbA) [Staphylococcus sp. 11-B-312]
ATGATAAATAGATTTATTGGTGTAGGACGATTAACTAAGGACCCAAATTTTGTAGAAGGACAAACTGCAATAGCAAACTT
CACAATAGCTTGCAACCGTCCATTTAAGAACAAAAATGGTGAACAGGATGCAGACTTCATCAATGTTGTAACGTTCCGCA
AACAAGCTGAAAACGTCAATAACTATGTACACAAAGGCGATATGGTTGGAATTGACGGTCGTATACAAACACGTAGTTAC
GAAAACAAAGAAGGTAAACGTATATTCGTTACCGAAGTAGTGGCGGACAGTGTTCAATTCATGGAACCTAAATCACAATC
TAAAGGACAATCTCAACAACAAAGTGGACAAGCTAAACCACAACAGCAACCAGTAAGCGATAATCCTTTTGCAAATGCAA
ACGGCCCTATTGATATTAGTGATGATGATTTACCATTTTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-101)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

48.837

100

0.575
  ssb Latilactobacillus sakei subsp. sakei 23K

47.059

100

0.548
  ssbB Bacillus subtilis subsp. subtilis str. 168

52.252

76.027

0.397
  ssb Vibrio cholerae strain A1552

31.034

100

0.37
  ssb Neisseria gonorrhoeae MS11

29.775

100

0.363