Detailed information
Overview
| Name | degQ | Type | Regulator |
| Locus tag | BAJP3144_RS15925 | Genome accession | NZ_CP082283 |
| Coordinates | 3209727..3209867 (-) | Length | 46 a.a. |
| NCBI ID | WP_003152043.1 | Uniprot ID | A3KLB4 |
| Organism | Bacillus amyloliquefaciens strain JP3144 | ||
| Function | modification of regulators (predicted from homology) Competence regulation |
||
Genomic Context
Location: 3204727..3214867
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| BAJP3144_RS15900 (BAJP3144_15900) | - | 3205054..3205437 (-) | 384 | WP_017419422.1 | hotdog fold thioesterase | - |
| BAJP3144_RS15905 (BAJP3144_15905) | comA | 3205459..3206103 (-) | 645 | WP_014418762.1 | response regulator transcription factor | Regulator |
| BAJP3144_RS15910 (BAJP3144_15910) | comP | 3206184..3208490 (-) | 2307 | WP_222893417.1 | sensor histidine kinase | Regulator |
| BAJP3144_RS15915 (BAJP3144_15915) | comX | 3208509..3208685 (-) | 177 | WP_017419424.1 | competence pheromone ComX | - |
| BAJP3144_RS15920 (BAJP3144_15920) | comQ | 3208700..3209575 (-) | 876 | WP_110124799.1 | polyprenyl synthetase family protein | Regulator |
| BAJP3144_RS15925 (BAJP3144_15925) | degQ | 3209727..3209867 (-) | 141 | WP_003152043.1 | degradation enzyme regulation protein DegQ | Regulator |
| BAJP3144_RS15930 (BAJP3144_15930) | - | 3210332..3210673 (+) | 342 | WP_021495366.1 | hypothetical protein | - |
| BAJP3144_RS15935 (BAJP3144_15935) | - | 3210680..3211903 (-) | 1224 | WP_007613436.1 | EAL and HDOD domain-containing protein | - |
| BAJP3144_RS15940 (BAJP3144_15940) | - | 3212033..3213499 (-) | 1467 | WP_014418767.1 | nicotinate phosphoribosyltransferase | - |
| BAJP3144_RS15945 (BAJP3144_15945) | - | 3213517..3214068 (-) | 552 | WP_003152033.1 | cysteine hydrolase family protein | - |
| BAJP3144_RS15950 (BAJP3144_15950) | - | 3214165..3214563 (-) | 399 | WP_003152031.1 | YueI family protein | - |
Sequence
Protein
Download Length: 46 a.a. Molecular weight: 5518.30 Da Isoelectric Point: 4.9432
>NTDB_id=528078 BAJP3144_RS15925 WP_003152043.1 3209727..3209867(-) (degQ) [Bacillus amyloliquefaciens strain JP3144]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS
Nucleotide
Download Length: 141 bp
>NTDB_id=528078 BAJP3144_RS15925 WP_003152043.1 3209727..3209867(-) (degQ) [Bacillus amyloliquefaciens strain JP3144]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| degQ | Bacillus subtilis subsp. subtilis str. 168 |
89.13 |
100 |
0.891 |