Detailed information    

insolico Bioinformatically predicted

Overview


Name   ccpA   Type   Regulator
Locus tag   I6J13_RS03030 Genome accession   NZ_CP068213
Coordinates   620431..621435 (-) Length   334 a.a.
NCBI ID   WP_006270669.1    Uniprot ID   A0AAD2Y396
Organism   Streptococcus constellatus strain FDAARGOS_1156     
Function   require for competence development (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 614033..708532 620431..621435 within 0


Gene organization within MGE regions


Location: 614033..708532
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  I6J13_RS02995 (I6J13_02995) - 614168..614481 (-) 314 Protein_597 DUF454 family protein -
  I6J13_RS03000 (I6J13_03000) vicX 614515..615318 (-) 804 WP_006270665.1 MBL fold metallo-hydrolase Regulator
  I6J13_RS03005 (I6J13_03005) micB 615320..616672 (-) 1353 WP_006270686.1 cell wall metabolism sensor histidine kinase VicK Regulator
  I6J13_RS03010 (I6J13_03010) micA 616665..617366 (-) 702 WP_003035055.1 response regulator YycF Regulator
  I6J13_RS03015 (I6J13_03015) - 617667..617999 (-) 333 WP_006268722.1 hypothetical protein -
  I6J13_RS03020 (I6J13_03020) - 618026..619339 (-) 1314 WP_006268747.1 glycosyltransferase family 4 protein -
  I6J13_RS03025 (I6J13_03025) - 619341..620339 (-) 999 WP_003068685.1 glycosyltransferase family 4 protein -
  I6J13_RS03030 (I6J13_03030) ccpA 620431..621435 (-) 1005 WP_006270669.1 catabolite control protein A Regulator
  I6J13_RS03035 (I6J13_03035) - 621700..622782 (+) 1083 WP_006270659.1 Xaa-Pro peptidase family protein -
  I6J13_RS03040 (I6J13_03040) - 623305..623886 (-) 582 WP_006270715.1 class I SAM-dependent methyltransferase -
  I6J13_RS03045 (I6J13_03045) galE 624145..625164 (-) 1020 WP_006270663.1 UDP-glucose 4-epimerase GalE -
  I6J13_RS03050 (I6J13_03050) rfbB 625199..626245 (-) 1047 WP_006270678.1 dTDP-glucose 4,6-dehydratase -
  I6J13_RS03055 (I6J13_03055) - 626277..626870 (-) 594 WP_006270667.1 dTDP-4-dehydrorhamnose 3,5-epimerase family protein -
  I6J13_RS03060 (I6J13_03060) rfbA 626874..627743 (-) 870 WP_006268635.1 glucose-1-phosphate thymidylyltransferase RfbA -
  I6J13_RS03065 (I6J13_03065) - 627886..628356 (-) 471 WP_006270651.1 8-oxo-dGTP diphosphatase -
  I6J13_RS03070 (I6J13_03070) - 628357..629454 (-) 1098 WP_006270698.1 FAD-binding oxidoreductase -
  I6J13_RS03075 (I6J13_03075) - 629467..630264 (-) 798 WP_006270711.1 Nif3-like dinuclear metal center hexameric protein -
  I6J13_RS03080 (I6J13_03080) - 630251..630940 (-) 690 WP_006270709.1 tRNA (adenine(22)-N(1))-methyltransferase TrmK -
  I6J13_RS03085 (I6J13_03085) - 631283..633748 (-) 2466 WP_006270674.1 LTA synthase family protein -
  I6J13_RS03090 (I6J13_03090) - 633748..635415 (-) 1668 WP_006270682.1 rhamnan synthesis F family protein -
  I6J13_RS03095 (I6J13_03095) - 635430..636632 (-) 1203 WP_006270670.1 ABC transporter ATP-binding protein -
  I6J13_RS03100 (I6J13_03100) - 636632..637438 (-) 807 WP_006270692.1 ABC transporter permease -
  I6J13_RS03105 (I6J13_03105) - 637441..638376 (-) 936 WP_006270702.1 glycosyltransferase family 2 protein -
  I6J13_RS03110 (I6J13_03110) cps2T 638373..639521 (-) 1149 WP_006270705.1 beta 1-4 rhamnosyltransferase Cps2T -
  I6J13_RS03115 (I6J13_03115) - 639710..640954 (-) 1245 WP_006270680.1 glycosyltransferase family 4 protein -
  I6J13_RS03120 (I6J13_03120) - 640958..642265 (-) 1308 WP_037566263.1 DUF2142 domain-containing protein -
  I6J13_RS03125 (I6J13_03125) - 642237..645224 (-) 2988 WP_006270684.1 rhamnan synthesis F family protein -
  I6J13_RS03130 (I6J13_03130) - 645248..646030 (-) 783 WP_006270716.1 glycosyltransferase family 2 protein -
  I6J13_RS03135 (I6J13_03135) - 646020..646379 (-) 360 WP_006270722.1 DUF2304 domain-containing protein -
  I6J13_RS03140 (I6J13_03140) - 646379..647095 (-) 717 WP_006270700.1 glycosyltransferase family 2 protein -
  I6J13_RS03145 (I6J13_03145) - 647092..648063 (-) 972 WP_006270694.1 glycosyltransferase -
  I6J13_RS03150 (I6J13_03150) - 648090..649037 (-) 948 WP_006270721.1 glycosyltransferase family A protein -
  I6J13_RS03155 (I6J13_03155) - 649044..650318 (-) 1275 WP_037566280.1 lipopolysaccharide biosynthesis protein -
  I6J13_RS03160 (I6J13_03160) rfbD 650390..651244 (-) 855 WP_006270689.1 dTDP-4-dehydrorhamnose reductase -
  I6J13_RS03165 (I6J13_03165) - 651365..652576 (-) 1212 WP_006270654.1 hypothetical protein -
  I6J13_RS03170 (I6J13_03170) - 652619..653548 (-) 930 WP_037566268.1 glycosyltransferase family 2 protein -
  I6J13_RS03175 (I6J13_03175) - 653896..654381 (-) 486 WP_003068625.1 thioesterase family protein -
  I6J13_RS09520 - 654837..654959 (-) 123 WP_006270720.1 hypothetical protein -
  I6J13_RS03180 (I6J13_03180) - 655349..656269 (+) 921 WP_022524552.1 IS30 family transposase -
  I6J13_RS03185 (I6J13_03185) - 656345..656563 (+) 219 WP_236587540.1 hypothetical protein -
  I6J13_RS03190 (I6J13_03190) - 656604..657980 (-) 1377 WP_006270446.1 DNA cytosine methyltransferase -
  I6J13_RS03195 (I6J13_03195) - 658057..658521 (-) 465 WP_006270426.1 hypothetical protein -
  I6J13_RS03200 (I6J13_03200) - 658723..660405 (-) 1683 WP_006270433.1 recombinase family protein -
  I6J13_RS03205 (I6J13_03205) - 660489..660656 (-) 168 WP_006270451.1 hypothetical protein -
  I6J13_RS03210 (I6J13_03210) - 661146..661556 (-) 411 WP_006270427.1 sigma-70 family RNA polymerase sigma factor -
  I6J13_RS03215 (I6J13_03215) - 661789..663537 (-) 1749 WP_006270455.1 ABC transporter ATP-binding protein -
  I6J13_RS03220 (I6J13_03220) - 663537..665306 (-) 1770 WP_006270438.1 ABC transporter ATP-binding protein -
  I6J13_RS03225 (I6J13_03225) - 665403..666359 (-) 957 WP_006270430.1 AraC family transcriptional regulator -
  I6J13_RS03230 (I6J13_03230) - 666362..667834 (-) 1473 WP_006270441.1 ABC transporter ATP-binding protein -
  I6J13_RS03235 (I6J13_03235) - 667844..668560 (-) 717 WP_006270439.1 energy-coupling factor transporter transmembrane component T -
  I6J13_RS03240 (I6J13_03240) - 668560..668994 (-) 435 WP_198429516.1 MptD family putative ECF transporter S component -
  I6J13_RS09550 (I6J13_03245) - 668969..669166 (-) 198 WP_306302101.1 MptD family putative ECF transporter S component -
  I6J13_RS03250 (I6J13_03250) - 669516..669866 (+) 351 WP_006270454.1 plasmid mobilization protein -
  I6J13_RS03255 (I6J13_03255) - 669872..671203 (+) 1332 WP_006270436.1 relaxase/mobilization nuclease domain-containing protein -
  I6J13_RS03260 (I6J13_03260) - 671228..671965 (-) 738 WP_006270449.1 TatD family hydrolase -
  I6J13_RS03265 (I6J13_03265) qatC 671958..673244 (-) 1287 WP_006270448.1 Qat anti-phage system QueC-like protein QatC -
  I6J13_RS03270 (I6J13_03270) - 673247..674032 (-) 786 WP_006270445.1 hypothetical protein -
  I6J13_RS03275 (I6J13_03275) - 674043..675863 (-) 1821 WP_006270453.1 P-loop NTPase fold protein -
  I6J13_RS03280 (I6J13_03280) - 675868..676077 (-) 210 WP_006270432.1 helix-turn-helix transcriptional regulator -
  I6J13_RS03285 (I6J13_03285) - 676218..676877 (-) 660 WP_006270421.1 hypothetical protein -
  I6J13_RS03290 (I6J13_03290) - 676920..685640 (-) 8721 WP_006270425.1 helicase-related protein -
  I6J13_RS03295 (I6J13_03295) - 685710..686717 (-) 1008 WP_006270429.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
  I6J13_RS03300 (I6J13_03300) - 686710..687315 (-) 606 WP_000612353.1 DUF6088 family protein -
  I6J13_RS03305 (I6J13_03305) - 687404..689107 (-) 1704 WP_006270428.1 DNA topoisomerase 3 -
  I6J13_RS03310 (I6J13_03310) - 689195..692251 (-) 3057 WP_006270423.1 VaFE repeat-containing surface-anchored protein -
  I6J13_RS03315 (I6J13_03315) - 692348..693877 (-) 1530 WP_006270456.1 CD1107 family mobile element protein -
  I6J13_RS03320 (I6J13_03320) - 693852..694091 (-) 240 WP_006270422.1 hypothetical protein -
  I6J13_RS03325 (I6J13_03325) - 694104..696236 (-) 2133 WP_006270452.1 CHAP domain-containing protein -
  I6J13_RS03330 (I6J13_03330) - 696240..698669 (-) 2430 WP_006270443.1 VirB4-like conjugal transfer ATPase, CD1110 family -
  I6J13_RS03335 (I6J13_03335) - 698581..698970 (-) 390 WP_022524555.1 PrgI family protein -
  I6J13_RS03340 (I6J13_03340) - 698974..699237 (-) 264 WP_006270447.1 hypothetical protein -
  I6J13_RS03345 (I6J13_03345) - 699255..700118 (-) 864 WP_000466908.1 VirB6/TrbL-like conjugal transfer protein, CD1112 family -
  I6J13_RS03350 (I6J13_03350) - 700138..700353 (-) 216 WP_000863833.1 Maff2 family mobile element protein -
  I6J13_RS03355 (I6J13_03355) - 700357..700668 (-) 312 WP_006270424.1 hypothetical protein -
  I6J13_RS03360 (I6J13_03360) - 700832..702616 (-) 1785 WP_006270444.1 VirD4-like conjugal transfer protein, CD1115 family -
  I6J13_RS03365 (I6J13_03365) - 702613..703098 (-) 486 WP_006270437.1 PcfB family protein -
  I6J13_RS03370 (I6J13_03370) - 703095..703946 (-) 852 WP_006270434.1 ATP-binding protein -
  I6J13_RS03375 (I6J13_03375) - 703943..704700 (-) 758 Protein_674 replication initiator protein A -
  I6J13_RS03380 (I6J13_03380) - 704787..705068 (-) 282 WP_115342918.1 CD1845 family protein -
  I6J13_RS03385 (I6J13_03385) - 705474..706556 (-) 1083 WP_115342919.1 acyltransferase family protein -
  I6J13_RS03390 (I6J13_03390) - 706570..708513 (-) 1944 WP_006270015.1 alkyl/aryl-sulfatase -

Sequence


Protein


Download         Length: 334 a.a.        Molecular weight: 37114.26 Da        Isoelectric Point: 5.8327

>NTDB_id=528031 I6J13_RS03030 WP_006270669.1 620431..621435(-) (ccpA) [Streptococcus constellatus strain FDAARGOS_1156]
MNTDDTVTIYDVAREAGVSMATVSRVVNGNKNVKENTRKKVLEVIDRLDYRPNAVARGLASKKTTTVGVVIPNITSSYFA
TLAKGIDDIAEMYKYNIVLANSDEDDDKEVSVVNTLFSKQVDGIIFMGYHLTEKIRSEFSRSRTPVVLAGTVDVEHQLPS
VNIDYKQATMDAVERLTKNNKKIAFVSGPLVDDINGKIRLIGYKEALKKAKLSYSEGLVFESKYSYEDGYQLAERVIASK
ATAAFVTGDELAAGLLNGLSDKDVNIPEDFEIITSDDSQVARFTRPNLTTIGQPLYDLGAISMRMLTKIMHKEELEEREV
VLAHGLIERRSTRK

Nucleotide


Download         Length: 1005 bp        

>NTDB_id=528031 I6J13_RS03030 WP_006270669.1 620431..621435(-) (ccpA) [Streptococcus constellatus strain FDAARGOS_1156]
ATGAACACAGACGATACTGTAACGATTTATGATGTCGCCCGTGAAGCGGGAGTTTCAATGGCGACCGTTAGCCGTGTAGT
AAACGGCAATAAAAATGTAAAGGAAAATACAAGAAAAAAAGTCTTGGAAGTCATTGATCGCCTTGACTATCGACCAAATG
CAGTTGCTCGTGGACTTGCCAGTAAGAAAACGACAACAGTAGGAGTTGTCATTCCAAACATTACAAGCAGTTATTTTGCA
ACGCTTGCGAAAGGAATTGATGACATCGCAGAGATGTATAAGTATAATATTGTTTTGGCAAATAGTGATGAGGATGATGA
CAAGGAAGTTTCTGTTGTCAATACCTTGTTCTCAAAACAAGTGGACGGCATTATCTTTATGGGATATCATCTAACAGAAA
AGATTCGTTCTGAGTTTTCTCGTTCAAGGACGCCGGTTGTACTTGCAGGAACGGTTGACGTGGAACATCAATTGCCAAGT
GTTAATATTGATTACAAACAAGCAACTATGGATGCAGTAGAGCGCCTCACTAAAAACAATAAAAAAATTGCTTTTGTGAG
TGGACCTTTGGTAGATGATATAAATGGTAAGATTCGTTTGATTGGTTACAAAGAAGCGTTGAAAAAAGCAAAACTTTCTT
ATAGTGAAGGGCTTGTCTTTGAGTCTAAATACAGCTATGAGGATGGCTATCAATTGGCAGAGCGTGTCATTGCTTCTAAA
GCGACAGCGGCCTTTGTGACTGGCGATGAACTGGCAGCTGGATTGTTAAATGGCTTATCAGACAAAGATGTAAATATACC
AGAAGATTTTGAAATCATTACTAGTGATGATTCGCAGGTAGCACGTTTTACTCGTCCGAATTTGACGACAATTGGACAAC
CTTTGTACGATCTTGGTGCGATTAGTATGCGCATGTTGACTAAGATTATGCACAAGGAAGAGTTGGAAGAACGTGAAGTG
GTGTTAGCTCATGGTCTTATTGAGCGCCGTTCAACAAGGAAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ccpA Streptococcus gordonii str. Challis substr. CH1

90.419

100

0.904

  ccpA Streptococcus pneumoniae D39

87.425

100

0.874

  ccpA Lactococcus lactis subsp. lactis strain DGCC12653

58.006

99.102

0.575