Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssb   Type   Machinery gene
Locus tag   JIO02_RS04245 Genome accession   NZ_CP067365
Coordinates   875029..875466 (+) Length   145 a.a.
NCBI ID   WP_064656104.1    Uniprot ID   -
Organism   Lacticaseibacillus rhamnosus strain KF7     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 866503..910136 875029..875466 within 0


Gene organization within MGE regions


Location: 866503..910136
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JIO02_RS04175 - 866503..867630 (-) 1128 WP_201251169.1 site-specific integrase -
  JIO02_RS04180 - 867737..868000 (-) 264 WP_201251170.1 hypothetical protein -
  JIO02_RS04185 - 868085..868684 (+) 600 WP_201251171.1 hypothetical protein -
  JIO02_RS04190 - 868926..869603 (-) 678 WP_201251172.1 transcriptional regulator -
  JIO02_RS04195 - 869665..870330 (-) 666 WP_015764317.1 LexA family protein -
  JIO02_RS04200 - 870499..870765 (+) 267 WP_201251173.1 helix-turn-helix transcriptional regulator -
  JIO02_RS04205 - 870766..871494 (+) 729 WP_201251174.1 phage regulatory protein/antirepressor Ant -
  JIO02_RS04210 - 871629..871874 (-) 246 WP_010489714.1 hypothetical protein -
  JIO02_RS04215 - 871949..872305 (+) 357 WP_005712707.1 DUF771 domain-containing protein -
  JIO02_RS04220 - 872390..872542 (+) 153 WP_201251175.1 hypothetical protein -
  JIO02_RS04225 - 872547..872750 (+) 204 WP_032953824.1 hypothetical protein -
  JIO02_RS04230 - 872768..873655 (+) 888 WP_201251176.1 DUF1351 domain-containing protein -
  JIO02_RS04235 - 873655..874371 (+) 717 WP_201251177.1 ERF family protein -
  JIO02_RS04240 - 874346..875014 (+) 669 WP_082272565.1 putative HNHc nuclease -
  JIO02_RS04245 ssb 875029..875466 (+) 438 WP_064656104.1 single-stranded DNA-binding protein Machinery gene
  JIO02_RS04250 - 875483..876313 (+) 831 WP_201251178.1 helix-turn-helix domain-containing protein -
  JIO02_RS04255 - 876310..877572 (+) 1263 WP_201251179.1 DnaB-like helicase C-terminal domain-containing protein -
  JIO02_RS04260 - 877574..877918 (+) 345 WP_201251180.1 hypothetical protein -
  JIO02_RS04265 - 877934..878410 (+) 477 WP_052657789.1 AP2 domain-containing protein -
  JIO02_RS04270 - 878514..878855 (+) 342 WP_236255565.1 RusA family crossover junction endodeoxyribonuclease -
  JIO02_RS15455 - 879045..879206 (+) 162 Protein_815 endonuclease -
  JIO02_RS15540 - 879218..879343 (+) 126 WP_268886779.1 hypothetical protein -
  JIO02_RS04280 - 879340..879876 (+) 537 WP_201251182.1 DUF1642 domain-containing protein -
  JIO02_RS04285 - 879873..880442 (+) 570 WP_201251183.1 DUF1642 domain-containing protein -
  JIO02_RS04290 - 880432..880647 (+) 216 WP_201251184.1 hypothetical protein -
  JIO02_RS04295 - 880676..880954 (+) 279 WP_236255568.1 hypothetical protein -
  JIO02_RS04300 - 880951..881181 (+) 231 WP_064554672.1 hypothetical protein -
  JIO02_RS04305 - 881192..881401 (+) 210 WP_064554669.1 hypothetical protein -
  JIO02_RS04310 - 881385..881549 (+) 165 WP_201251232.1 hypothetical protein -
  JIO02_RS04315 - 881583..882770 (-) 1188 WP_163601275.1 IS256 family transposase -
  JIO02_RS04320 - 882902..883162 (+) 261 WP_236255566.1 YopX family protein -
  JIO02_RS04325 - 883152..883328 (+) 177 WP_201251186.1 hypothetical protein -
  JIO02_RS04330 - 883318..883611 (+) 294 WP_201251187.1 hypothetical protein -
  JIO02_RS04335 - 883598..884020 (+) 423 WP_236255567.1 hypothetical protein -
  JIO02_RS04340 - 884010..884378 (+) 369 WP_201251188.1 hypothetical protein -
  JIO02_RS04345 - 884375..884584 (+) 210 WP_201251189.1 hypothetical protein -
  JIO02_RS04350 - 884980..885162 (+) 183 WP_029943634.1 hypothetical protein -
  JIO02_RS04355 - 885454..885897 (+) 444 WP_201251190.1 ArpU family phage packaging/lysis transcriptional regulator -
  JIO02_RS04360 - 886194..887111 (+) 918 WP_201251191.1 DNA adenine methylase -
  JIO02_RS04365 - 887130..888263 (+) 1134 WP_201251192.1 metallophosphoesterase family protein -
  JIO02_RS04370 - 888268..888582 (+) 315 WP_413229419.1 ribonucleoside-diphosphate reductase -
  JIO02_RS04375 - 888717..889511 (+) 795 WP_201251194.1 HNH endonuclease -
  JIO02_RS04380 - 889712..890167 (+) 456 WP_005712753.1 P27 family phage terminase small subunit -
  JIO02_RS04385 - 890189..891901 (+) 1713 WP_033573339.1 terminase large subunit -
  JIO02_RS04390 - 891913..892104 (+) 192 WP_003661399.1 hypothetical protein -
  JIO02_RS04395 - 892110..893363 (+) 1254 WP_048487181.1 phage portal protein -
  JIO02_RS04400 - 893317..893946 (+) 630 WP_015764348.1 HK97 family phage prohead protease -
  JIO02_RS04405 - 893988..895190 (+) 1203 WP_201251195.1 phage major capsid protein -
  JIO02_RS04410 - 895208..895447 (+) 240 WP_005712764.1 Ig-like domain-containing protein -
  JIO02_RS04415 - 895458..895817 (+) 360 WP_015764350.1 head-tail connector protein -
  JIO02_RS04420 - 895807..896136 (+) 330 WP_033573335.1 head-tail adaptor protein -
  JIO02_RS04425 - 896136..896522 (+) 387 WP_033573334.1 HK97-gp10 family putative phage morphogenesis protein -
  JIO02_RS04430 - 896522..896908 (+) 387 WP_033573333.1 hypothetical protein -
  JIO02_RS04435 - 896942..897559 (+) 618 WP_201251196.1 major tail protein -
  JIO02_RS15460 - 897581..897661 (+) 81 Protein_849 DNA-binding protein -
  JIO02_RS04445 gpG 897732..898145 (+) 414 WP_003661382.1 phage tail assembly chaperone G -
  JIO02_RS04450 - 898268..903130 (+) 4863 WP_201251197.1 phage tail tape measure protein -
  JIO02_RS04455 - 903131..905083 (+) 1953 WP_201251198.1 distal tail protein Dit -
  JIO02_RS04460 - 905084..907783 (+) 2700 WP_201251199.1 phage tail protein -
  JIO02_RS04465 - 907799..908128 (+) 330 WP_201251200.1 hypothetical protein -
  JIO02_RS04470 - 908125..908268 (+) 144 WP_005688592.1 XkdX family protein -
  JIO02_RS04475 - 908298..908591 (+) 294 WP_201251201.1 hypothetical protein -
  JIO02_RS04480 - 908581..909015 (+) 435 WP_201251202.1 phage holin -
  JIO02_RS04485 - 909015..910136 (+) 1122 WP_201251203.1 GH25 family lysozyme -

Sequence

Protein


Download         Length: 145 a.a.        Molecular weight: 15826.39 Da        Isoelectric Point: 5.1769

>NTDB_id=525640 JIO02_RS04245 WP_064656104.1 875029..875466(+) (ssb) [Lacticaseibacillus rhamnosus strain KF7]
MLNSVALTGRLTKDVDLRYTQSGTAVGSFTIAVDRQFRSANGERETDFISCAIWRKSAENLAKFTHKGSLIGVEGHVQTR
TYDNAQGNKVYVTEVIVENFALLEPRQTSQESQQRSANNPAAASQGNGFANNGQPVDVSDDDLPF

Nucleotide


Download         Length: 438 bp        

>NTDB_id=525640 JIO02_RS04245 WP_064656104.1 875029..875466(+) (ssb) [Lacticaseibacillus rhamnosus strain KF7]
ATGCTTAATTCAGTTGCTCTAACAGGCAGATTAACTAAAGACGTTGACCTTCGCTACACACAAAGCGGAACAGCAGTTGG
CTCATTTACGATTGCTGTTGATCGCCAATTTCGTAGCGCAAATGGTGAACGTGAAACTGACTTCATAAGTTGTGCTATCT
GGCGCAAGTCAGCTGAGAACCTCGCTAAGTTCACGCACAAGGGTTCGCTCATTGGTGTCGAAGGTCATGTCCAGACACGC
ACATACGACAACGCACAAGGTAATAAGGTATACGTGACTGAGGTGATCGTTGAGAATTTCGCCTTGCTTGAGCCACGGCA
GACGTCTCAGGAAAGCCAACAACGATCGGCTAATAACCCAGCGGCCGCAAGCCAAGGCAACGGCTTTGCTAACAATGGCC
AGCCAGTCGATGTCAGCGATGATGATCTTCCATTCTAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-102)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Latilactobacillus sakei subsp. sakei 23K

55.882

100

0.655
  ssbA Bacillus subtilis subsp. subtilis str. 168

46.512

100

0.552
  ssbB Bacillus subtilis subsp. subtilis str. 168

52.83

73.103

0.386
  ssbB Streptococcus sobrinus strain NIDR 6715-7

36.552

100

0.366
  ssb Neisseria gonorrhoeae MS11

30.814

100

0.366