Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssb   Type   Machinery gene
Locus tag   JFL49_RS03400 Genome accession   NZ_CP066558
Coordinates   695441..695893 (+) Length   150 a.a.
NCBI ID   WP_012340854.1    Uniprot ID   W0R5B1
Organism   Histophilus somni strain ASc-MMNZ-VFA-070     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 687775..760688 695441..695893 within 0


Gene organization within MGE regions


Location: 687775..760688
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JFL49_RS03365 (JFL49_03365) - 687903..688727 (+) 825 WP_012340861.1 ParA family protein -
  JFL49_RS03370 (JFL49_03370) dnaB 688739..690100 (+) 1362 WP_012340860.1 replicative DNA helicase -
  JFL49_RS03375 (JFL49_03375) - 690109..691755 (+) 1647 WP_012340859.1 ParB family protein -
  JFL49_RS03380 (JFL49_03380) - 691748..692305 (+) 558 WP_012340858.1 DUF2857 domain-containing protein -
  JFL49_RS03385 (JFL49_03385) - 692464..693654 (+) 1191 WP_014325837.1 STY4528 family pathogenicity island replication protein -
  JFL49_RS03390 (JFL49_03390) - 693833..694591 (+) 759 WP_012340856.1 PFL_4669 family integrating conjugative element protein -
  JFL49_RS03395 (JFL49_03395) - 694600..695085 (+) 486 WP_012340855.1 DUF3158 family protein -
  JFL49_RS03400 (JFL49_03400) ssb 695441..695893 (+) 453 WP_012340854.1 single-stranded DNA-binding protein Machinery gene
  JFL49_RS03405 (JFL49_03405) - 696200..696388 (+) 189 WP_011200812.1 hypothetical protein -
  JFL49_RS03410 (JFL49_03410) - 696429..696731 (+) 303 WP_011200813.1 hypothetical protein -
  JFL49_RS03415 (JFL49_03415) - 696731..698041 (+) 1311 WP_011200814.1 ISL3 family transposase -
  JFL49_RS03420 (JFL49_03420) tet(H) 698137..699339 (-) 1203 WP_198986592.1 tetracycline efflux MFS transporter Tet(H) -
  JFL49_RS03425 (JFL49_03425) tetR(H) 699431..700054 (+) 624 WP_006248868.1 tetracycline resistance transcriptional repressor TetR(H) -
  JFL49_RS03430 (JFL49_03430) - 700057..700575 (-) 519 WP_006248869.1 hypothetical protein -
  JFL49_RS03435 (JFL49_03435) - 700624..700803 (-) 180 WP_006248870.1 hypothetical protein -
  JFL49_RS03440 (JFL49_03440) - 700916..701047 (+) 132 WP_230588116.1 alcohol dehydrogenase catalytic domain-containing protein -
  JFL49_RS03445 (JFL49_03445) - 701137..702684 (-) 1548 WP_006248871.1 multicopper oxidase family protein -
  JFL49_RS03450 (JFL49_03450) - 702700..703155 (-) 456 WP_005612095.1 DUF411 domain-containing protein -
  JFL49_RS03455 (JFL49_03455) - 703337..703753 (-) 417 WP_316244961.1 DUF6803 family protein -
  JFL49_RS03460 (JFL49_03460) - 703656..704423 (+) 768 WP_012340839.1 aldo/keto reductase -
  JFL49_RS03465 (JFL49_03465) - 704962..705672 (-) 711 WP_006248874.1 hypothetical protein -
  JFL49_RS03470 (JFL49_03470) - 706149..706667 (+) 519 WP_006248876.1 hypothetical protein -
  JFL49_RS03475 (JFL49_03475) - 706827..708878 (+) 2052 WP_012340838.1 DNA topoisomerase III -
  JFL49_RS03480 (JFL49_03480) - 708939..709076 (-) 138 WP_155242642.1 hypothetical protein -
  JFL49_RS03485 (JFL49_03485) - 709696..710127 (+) 432 WP_006248878.1 STY4534 family ICE replication protein -
  JFL49_RS03490 (JFL49_03490) - 710233..710913 (+) 681 WP_006248879.1 hypothetical protein -
  JFL49_RS03495 (JFL49_03495) - 710939..711346 (+) 408 WP_014325831.1 hypothetical protein -
  JFL49_RS03500 (JFL49_03500) - 711426..711788 (+) 363 WP_006248881.1 hypothetical protein -
  JFL49_RS03505 (JFL49_03505) - 711901..712161 (+) 261 WP_006248882.1 hypothetical protein -
  JFL49_RS03510 (JFL49_03510) - 712320..712949 (+) 630 WP_006248884.1 hypothetical protein -
  JFL49_RS03515 (JFL49_03515) - 712949..713722 (+) 774 WP_006248885.1 TIGR03759 family integrating conjugative element protein -
  JFL49_RS03520 (JFL49_03520) - 713701..714471 (+) 771 WP_012340835.1 hypothetical protein -
  JFL49_RS03525 (JFL49_03525) - 714474..714980 (+) 507 WP_012340834.1 integrating conjugative element protein -
  JFL49_RS03530 (JFL49_03530) traD 714980..717181 (+) 2202 WP_014325830.1 type IV conjugative transfer system coupling protein TraD -
  JFL49_RS03535 (JFL49_03535) - 717174..717527 (+) 354 WP_006248889.1 hypothetical protein -
  JFL49_RS03540 (JFL49_03540) - 717524..718219 (+) 696 WP_012340831.1 TIGR03747 family integrating conjugative element membrane protein -
  JFL49_RS03545 (JFL49_03545) - 718251..718622 (-) 372 WP_021265447.1 hypothetical protein -
  JFL49_RS03550 (JFL49_03550) - 718821..719147 (+) 327 WP_006248892.1 RAQPRD family integrative conjugative element protein -
  JFL49_RS03555 (JFL49_03555) - 719147..719380 (+) 234 WP_014325829.1 DUF3262 family protein -
  JFL49_RS03560 (JFL49_03560) - 719395..719784 (+) 390 WP_006248894.1 DUF2976 domain-containing protein -
  JFL49_RS03565 (JFL49_03565) - 719807..720172 (+) 366 WP_012340829.1 TIGR03750 family conjugal transfer protein -
  JFL49_RS03570 (JFL49_03570) - 720176..720820 (+) 645 WP_012340828.1 PFL_4703 family integrating conjugative element protein -
  JFL49_RS03575 (JFL49_03575) - 720820..721704 (+) 885 WP_012340827.1 TIGR03749 family integrating conjugative element protein -
  JFL49_RS03580 (JFL49_03580) - 721716..723170 (+) 1455 WP_012340826.1 TIGR03752 family integrating conjugative element protein -
  JFL49_RS03585 (JFL49_03585) - 723183..723581 (+) 399 WP_012340824.1 TIGR03751 family conjugal transfer lipoprotein -
  JFL49_RS03590 (JFL49_03590) - 723584..726421 (+) 2838 WP_012340823.1 conjugative transfer ATPase -
  JFL49_RS03595 (JFL49_03595) - 726421..726849 (+) 429 WP_012340822.1 hypothetical protein -
  JFL49_RS03600 (JFL49_03600) - 726866..727156 (+) 291 WP_142783019.1 hemophilus-specific protein -
  JFL49_RS03605 (JFL49_03605) - 727167..728639 (+) 1473 WP_012340820.1 conjugal transfer protein TraG N-terminal domain-containing protein -
  JFL49_RS03610 (JFL49_03610) - 728685..729026 (-) 342 WP_012340819.1 hypothetical protein -
  JFL49_RS03615 (JFL49_03615) tenpIN 729047..729517 (-) 471 WP_012340818.1 type III toxin-antitoxin system TenpIN family toxin -
  JFL49_RS03620 (JFL49_03620) - 729733..730161 (-) 429 WP_012340817.1 hypothetical protein -
  JFL49_RS03625 (JFL49_03625) - 730182..732194 (-) 2013 WP_012340816.1 integrating conjugative element protein -
  JFL49_RS03630 (JFL49_03630) - 732212..733153 (-) 942 WP_012340815.1 TIGR03756 family integrating conjugative element protein -
  JFL49_RS03635 (JFL49_03635) - 733150..733593 (-) 444 WP_012340813.1 TIGR03757 family integrating conjugative element protein -
  JFL49_RS03640 (JFL49_03640) - 733967..734320 (+) 354 WP_012340812.1 hypothetical protein -
  JFL49_RS03645 (JFL49_03645) - 734392..734637 (+) 246 WP_012340811.1 hypothetical protein -
  JFL49_RS03650 (JFL49_03650) - 734736..735131 (+) 396 WP_012340810.1 hypothetical protein -
  JFL49_RS03655 (JFL49_03655) - 735209..736051 (+) 843 WP_012340809.1 hypothetical protein -
  JFL49_RS03660 (JFL49_03660) - 736167..736574 (+) 408 WP_012340808.1 hypothetical protein -
  JFL49_RS03665 (JFL49_03665) - 736819..737793 (+) 975 WP_012340807.1 ArdC family protein -
  JFL49_RS03670 (JFL49_03670) - 737933..738679 (+) 747 WP_012340806.1 hypothetical protein -
  JFL49_RS03675 (JFL49_03675) - 738752..739549 (+) 798 WP_014325828.1 N-6 DNA methylase -
  JFL49_RS03680 (JFL49_03680) mobH 739977..741956 (+) 1980 WP_014325827.1 MobH family relaxase -
  JFL49_RS03685 (JFL49_03685) - 742064..742876 (+) 813 WP_373419113.1 tyrosine-type recombinase/integrase -
  JFL49_RS03690 (JFL49_03690) - 743054..743602 (+) 549 Protein_721 IS30-like element ISApl1 family transposase -
  JFL49_RS03695 (JFL49_03695) - 743944..745437 (-) 1494 WP_087437258.1 IS91-like element ISVsa3 family transposase -
  JFL49_RS03700 (JFL49_03700) - 745549..745854 (-) 306 WP_001255015.1 LysR family transcriptional regulator -
  JFL49_RS03705 (JFL49_03705) floR 745882..747096 (-) 1215 WP_014325824.1 chloramphenicol/florfenicol efflux MFS transporter FloR -
  JFL49_RS10090 - 747373..748257 (-) 885 WP_001447541.1 DUF3363 domain-containing protein -
  JFL49_RS03715 (JFL49_03715) - 748288..748545 (-) 258 Protein_726 IS91 family transposase -
  JFL49_RS03720 (JFL49_03720) - 748885..750177 (-) 1293 WP_014325823.1 IS91 family transposase -
  JFL49_RS03725 (JFL49_03725) sul2 750344..751186 (+) 843 WP_198986596.1 sulfonamide-resistant dihydropteroate synthase Sul2 -
  JFL49_RS03730 (JFL49_03730) aph(3'')-Ib 751355..752158 (+) 804 WP_075319815.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
  JFL49_RS03735 (JFL49_03735) - 752158..752994 (+) 837 WP_000480968.1 aminoglycoside O-phosphotransferase APH(6)-Id -
  JFL49_RS10095 - 753092..753193 (-) 102 Protein_731 IS5/IS1182 family transposase -
  JFL49_RS03740 (JFL49_03740) - 753330..754145 (+) 816 WP_000018321.1 aminoglycoside O-phosphotransferase APH(3')-Ia -
  JFL49_RS03745 (JFL49_03745) - 754299..755021 (-) 723 WP_021112540.1 C45 family autoproteolytic acyltransferase/hydolase -
  JFL49_RS03755 (JFL49_03755) - 755062..756072 (+) 1011 WP_021112546.1 hypothetical protein -
  JFL49_RS03760 (JFL49_03760) - 756173..757147 (+) 975 Protein_735 IS30-like element ISApl1 family transposase -
  JFL49_RS03765 (JFL49_03765) - 757421..758320 (-) 900 WP_012340803.1 tyrosine-type recombinase/integrase -
  JFL49_RS03770 (JFL49_03770) - 758470..758907 (+) 438 WP_012340802.1 DNA-binding protein -
  JFL49_RS03775 (JFL49_03775) - 759639..760202 (-) 564 WP_223667064.1 PBECR4 domain-containing protein -

Sequence


Protein


Download         Length: 150 a.a.        Molecular weight: 17204.13 Da        Isoelectric Point: 5.2733

>NTDB_id=520830 JFL49_RS03400 WP_012340854.1 695441..695893(+) (ssb) [Histophilus somni strain ASc-MMNZ-VFA-070]
MAGINKVIIVGNLGNDPEMRTMPNGEAVANISVATSESWTDKNTGERREVTEWHRIVFYRRYAEICGQYLRKGSKIYIEG
KLRTRKWQDQNGQERYTTEIQGELLQMLDSRNATNSVDGQQSNYQAMSQSPKATHPQDLPMDNFDDDIPF

Nucleotide


Download         Length: 453 bp        

>NTDB_id=520830 JFL49_RS03400 WP_012340854.1 695441..695893(+) (ssb) [Histophilus somni strain ASc-MMNZ-VFA-070]
ATGGCAGGAATCAATAAAGTGATTATTGTCGGTAATCTTGGCAACGATCCTGAAATGCGGACTATGCCTAATGGTGAAGC
AGTTGCTAATATTAGTGTGGCAACTTCTGAAAGTTGGACGGATAAAAATACCGGAGAACGTCGAGAAGTCACTGAATGGC
ATCGTATCGTTTTTTATCGCCGTTATGCTGAAATTTGTGGTCAGTACCTACGTAAAGGCTCTAAAATTTATATCGAAGGA
AAATTACGGACACGTAAGTGGCAAGACCAAAACGGGCAAGAGCGTTATACAACCGAAATCCAAGGTGAACTATTACAAAT
GTTAGATAGCCGTAATGCTACAAATAGCGTAGATGGACAACAATCTAACTATCAAGCTATGAGCCAATCTCCAAAAGCAA
CACATCCACAAGATTTACCAATGGATAACTTTGATGATGATATTCCGTTCTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB W0R5B1

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssb Glaesserella parasuis strain SC1401

63.333

100

0.76

  ssb Vibrio cholerae strain A1552

51.724

100

0.6

  ssb Neisseria gonorrhoeae MS11

45.665

100

0.527

  ssb Neisseria meningitidis MC58

45.087

100

0.52

  ssbA Bacillus subtilis subsp. subtilis str. 168

31.818

100

0.373