Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | STRR_RS01480 | Genome accession | NZ_CP065788 |
| Coordinates | 272722..272931 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain RR | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 267722..277931
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STRR_RS01450 (STRR_01440) | - | 268132..268671 (+) | 540 | WP_370869438.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| STRR_RS01455 (STRR_01445) | - | 268981..269538 (+) | 558 | WP_071417478.1 | ECF transporter S component | - |
| STRR_RS01460 (STRR_01450) | - | 269541..270191 (+) | 651 | WP_071417477.1 | phosphatase PAP2 family protein | - |
| STRR_RS01465 (STRR_01455) | comR | 270386..271285 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| STRR_RS01470 | - | 271523..271954 (+) | 432 | Protein_249 | cysteine peptidase family C39 domain-containing protein | - |
| STRR_RS01475 | - | 271984..272649 (+) | 666 | Protein_250 | ABC transporter transmembrane domain-containing protein | - |
| STRR_RS01480 | comA | 272722..272931 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| STRR_RS01485 (STRR_01480) | - | 272986..273554 (+) | 569 | Protein_252 | ATP-binding cassette domain-containing protein | - |
| STRR_RS01490 (STRR_01485) | - | 273662..273979 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| STRR_RS01495 | - | 273942..274226 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| STRR_RS01500 | - | 274466..275362 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| STRR_RS01505 (STRR_01495) | - | 275767..276282 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| STRR_RS01510 (STRR_01500) | - | 276307..276609 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| STRR_RS01515 (STRR_01505) | - | 276621..276932 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=514304 STRR_RS01480 WP_002946147.1 272722..272931(+) (comA) [Streptococcus thermophilus strain RR]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=514304 STRR_RS01480 WP_002946147.1 272722..272931(+) (comA) [Streptococcus thermophilus strain RR]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |