Detailed information
Bioinformatically predicted
Overview
| Name | comA | Type | Regulator |
| Locus tag | STCNRZ385_RS01565 | Genome accession | NZ_CP065495 |
| Coordinates | 282369..282578 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CNRZ385 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 277369..287578
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STCNRZ385_RS01535 (STCNRZ385_01535) | - | 277807..278316 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| STCNRZ385_RS01540 (STCNRZ385_01540) | - | 278628..279185 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| STCNRZ385_RS01545 (STCNRZ385_01545) | - | 279188..279838 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| STCNRZ385_RS01550 (STCNRZ385_01550) | comR | 280033..280932 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| STCNRZ385_RS01555 | - | 281170..281601 (+) | 432 | Protein_251 | cysteine peptidase family C39 domain-containing protein | - |
| STCNRZ385_RS01560 | - | 281631..282347 (+) | 717 | Protein_252 | ABC transporter transmembrane domain-containing protein | - |
| STCNRZ385_RS01565 | comA | 282369..282578 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| STCNRZ385_RS01570 (STCNRZ385_01575) | - | 282633..283201 (+) | 569 | Protein_254 | ATP-binding cassette domain-containing protein | - |
| STCNRZ385_RS01575 (STCNRZ385_01580) | - | 283309..283626 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| STCNRZ385_RS01580 | - | 283589..283873 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| STCNRZ385_RS01585 | - | 284113..285009 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| STCNRZ385_RS01590 (STCNRZ385_01590) | - | 285414..285929 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| STCNRZ385_RS01595 (STCNRZ385_01595) | - | 285954..286256 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| STCNRZ385_RS01600 (STCNRZ385_01600) | - | 286268..286579 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=511003 STCNRZ385_RS01565 WP_002946147.1 282369..282578(+) (comA) [Streptococcus thermophilus strain CNRZ385]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=511003 STCNRZ385_RS01565 WP_002946147.1 282369..282578(+) (comA) [Streptococcus thermophilus strain CNRZ385]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |