Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | ST4145_RS01450 | Genome accession | NZ_CP065492 |
| Coordinates | 263866..264075 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain 4145 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 258866..269075
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ST4145_RS01420 (ST4145_01410) | - | 259304..259813 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| ST4145_RS01425 (ST4145_01415) | - | 260125..260682 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| ST4145_RS01430 (ST4145_01420) | - | 260685..261335 (+) | 651 | WP_024009730.1 | phosphatase PAP2 family protein | - |
| ST4145_RS01435 (ST4145_01425) | comR | 261530..262429 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| ST4145_RS01440 | - | 262667..263098 (+) | 432 | Protein_230 | cysteine peptidase family C39 domain-containing protein | - |
| ST4145_RS01445 | - | 263128..263697 (+) | 570 | Protein_231 | ABC transporter transmembrane domain-containing protein | - |
| ST4145_RS01450 | comA | 263866..264075 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| ST4145_RS01455 (ST4145_01445) | - | 264130..264698 (+) | 569 | Protein_233 | ATP-binding cassette domain-containing protein | - |
| ST4145_RS01460 | - | 264929..265117 (+) | 189 | WP_224103239.1 | hypothetical protein | - |
| ST4145_RS01465 | - | 265085..265369 (-) | 285 | WP_232557103.1 | hypothetical protein | - |
| ST4145_RS01470 | - | 265610..265912 (-) | 303 | WP_224103194.1 | hypothetical protein | - |
| ST4145_RS01475 | - | 266136..266507 (-) | 372 | WP_224103195.1 | hypothetical protein | - |
| ST4145_RS01480 (ST4145_01460) | - | 266913..267428 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| ST4145_RS01485 (ST4145_01465) | - | 267453..267755 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| ST4145_RS01490 (ST4145_01470) | - | 267767..268078 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=510882 ST4145_RS01450 WP_002946147.1 263866..264075(+) (comA) [Streptococcus thermophilus strain 4145]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=510882 ST4145_RS01450 WP_002946147.1 263866..264075(+) (comA) [Streptococcus thermophilus strain 4145]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |