Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | STCNRZ760_RS01470 | Genome accession | NZ_CP065482 |
| Coordinates | 265685..265894 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain CNRZ760 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 260685..270894
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| STCNRZ760_RS01445 (STCNRZ760_01435) | - | 261122..261631 (+) | 510 | WP_011680717.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| STCNRZ760_RS01450 (STCNRZ760_01440) | - | 261943..262500 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| STCNRZ760_RS01455 (STCNRZ760_01445) | - | 262503..263153 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| STCNRZ760_RS01460 (STCNRZ760_01450) | comR | 263348..264247 (+) | 900 | WP_011225448.1 | helix-turn-helix domain-containing protein | Regulator |
| STCNRZ760_RS01465 (STCNRZ760_01455) | - | 264485..265663 (+) | 1179 | Protein_235 | ABC transporter transmembrane domain-containing protein | - |
| STCNRZ760_RS01470 | comA | 265685..265894 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| STCNRZ760_RS01475 (STCNRZ760_01470) | - | 265949..266517 (+) | 569 | Protein_237 | ATP-binding cassette domain-containing protein | - |
| STCNRZ760_RS01480 (STCNRZ760_01475) | - | 266625..266936 (+) | 312 | WP_022096570.1 | DUF805 domain-containing protein | - |
| STCNRZ760_RS01485 | - | 266904..267188 (-) | 285 | WP_232085805.1 | hypothetical protein | - |
| STCNRZ760_RS01490 | - | 267157..267504 (-) | 348 | WP_232089310.1 | DUF4173 domain-containing protein | - |
| STCNRZ760_RS01495 | - | 267429..268325 (-) | 897 | WP_224103642.1 | urease cluster protein | - |
| STCNRZ760_RS01500 (STCNRZ760_01485) | - | 268730..269245 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| STCNRZ760_RS01505 (STCNRZ760_01490) | - | 269270..269572 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| STCNRZ760_RS01510 (STCNRZ760_01495) | - | 269584..269895 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=510291 STCNRZ760_RS01470 WP_002946147.1 265685..265894(+) (comA) [Streptococcus thermophilus strain CNRZ760]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=510291 STCNRZ760_RS01470 WP_002946147.1 265685..265894(+) (comA) [Streptococcus thermophilus strain CNRZ760]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |