Detailed information
Overview
| Name | comA | Type | Regulator |
| Locus tag | ST4078_RS01530 | Genome accession | NZ_CP065477 |
| Coordinates | 273012..273221 (+) | Length | 69 a.a. |
| NCBI ID | WP_002946147.1 | Uniprot ID | - |
| Organism | Streptococcus thermophilus strain 4078 | ||
| Function | processing and transport of ComC (predicted from homology) Competence regulation |
||
Genomic Context
Location: 268012..278221
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ST4078_RS01500 (ST4078_01480) | - | 268450..268959 (+) | 510 | WP_014607952.1 | tRNA (cytidine(34)-2'-O)-methyltransferase | - |
| ST4078_RS01505 (ST4078_01485) | - | 269271..269828 (+) | 558 | WP_002949523.1 | ECF transporter S component | - |
| ST4078_RS01510 (ST4078_01490) | - | 269831..270481 (+) | 651 | WP_011225447.1 | phosphatase PAP2 family protein | - |
| ST4078_RS01515 (ST4078_01495) | comR | 270676..271575 (+) | 900 | WP_014607953.1 | helix-turn-helix domain-containing protein | Regulator |
| ST4078_RS01520 | - | 271813..272244 (+) | 432 | Protein_244 | cysteine peptidase family C39 domain-containing protein | - |
| ST4078_RS01525 | - | 272274..272939 (+) | 666 | Protein_245 | ABC transporter transmembrane domain-containing protein | - |
| ST4078_RS01530 | comA | 273012..273221 (+) | 210 | WP_002946147.1 | hypothetical protein | Regulator |
| ST4078_RS01535 (ST4078_01520) | - | 273276..273844 (+) | 569 | Protein_247 | ATP-binding cassette domain-containing protein | - |
| ST4078_RS01540 (ST4078_01525) | - | 273952..274269 (+) | 318 | WP_011225454.1 | DUF805 domain-containing protein | - |
| ST4078_RS01545 | - | 274232..274516 (-) | 285 | WP_014727318.1 | hypothetical protein | - |
| ST4078_RS01550 | - | 274756..275652 (-) | 897 | WP_224102957.1 | urease cluster protein | - |
| ST4078_RS01555 (ST4078_01535) | - | 276057..276572 (+) | 516 | WP_002949547.1 | AmiS/UreI family transporter | - |
| ST4078_RS01560 (ST4078_01540) | - | 276597..276899 (+) | 303 | WP_002886558.1 | urease subunit gamma | - |
| ST4078_RS01565 (ST4078_01545) | - | 276911..277222 (+) | 312 | WP_002886559.1 | urease subunit beta | - |
Sequence
Protein
Download Length: 69 a.a. Molecular weight: 8157.54 Da Isoelectric Point: 9.7339
>NTDB_id=509990 ST4078_RS01530 WP_002946147.1 273012..273221(+) (comA) [Streptococcus thermophilus strain 4078]
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
MITYSMLLNYFTTPLINIIYLQSKIQQAKVANNCLQEVYVVNKEEKGQLKDLSFKQLDLKGVSHRFRYQ
Nucleotide
Download Length: 210 bp
>NTDB_id=509990 ST4078_RS01530 WP_002946147.1 273012..273221(+) (comA) [Streptococcus thermophilus strain 4078]
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
TTGATTACCTATAGTATGTTGCTTAATTATTTTACGACTCCTTTAATTAATATTATCTATCTTCAATCTAAGATTCAGCA
AGCCAAGGTAGCCAATAATTGTCTTCAAGAAGTTTATGTTGTGAATAAGGAAGAAAAAGGTCAACTCAAAGATTTATCCT
TTAAACAATTAGACTTAAAAGGTGTTAGTCATCGTTTCAGATACCAATAA
Domains
No domain identified.
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comA | Streptococcus gordonii str. Challis substr. CH1 |
54.167 |
100 |
0.565 |
| comA | Streptococcus mitis NCTC 12261 |
52.778 |
100 |
0.551 |
| comA | Streptococcus pneumoniae Rx1 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae D39 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae R6 |
51.389 |
100 |
0.536 |
| comA | Streptococcus pneumoniae TIGR4 |
51.389 |
100 |
0.536 |
| comA | Streptococcus mitis SK321 |
50 |
100 |
0.522 |
| comA/nlmT | Streptococcus mutans UA159 |
44.286 |
100 |
0.449 |