Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGE   Type   Machinery gene
Locus tag   MY9_RS12430 Genome accession   NC_017743
Coordinates   2463468..2463815 (-) Length   115 a.a.
NCBI ID   WP_014664592.1    Uniprot ID   -
Organism   Bacillus sp. JS     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2458468..2468815
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MY9_RS12385 (MY9_2482) sinI 2459001..2459174 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MY9_RS12390 (MY9_2483) sinR 2459208..2459543 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MY9_RS12395 (MY9_2484) tasA 2459637..2460422 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  MY9_RS12400 (MY9_2485) - 2460486..2461058 (-) 573 WP_014664587.1 signal peptidase I -
  MY9_RS12405 (MY9_2486) tapA 2461042..2461797 (-) 756 WP_014664588.1 amyloid fiber anchoring/assembly protein TapA -
  MY9_RS12410 (MY9_2487) - 2462069..2462395 (+) 327 WP_014664589.1 YqzG/YhdC family protein -
  MY9_RS12415 (MY9_2488) - 2462436..2462615 (-) 180 WP_014480252.1 YqzE family protein -
  MY9_RS12420 (MY9_2489) comGG 2462687..2463061 (-) 375 WP_014664590.1 competence type IV pilus minor pilin ComGG Machinery gene
  MY9_RS12425 (MY9_2490) comGF 2463062..2463442 (-) 381 WP_014664591.1 competence type IV pilus minor pilin ComGF Machinery gene
  MY9_RS12430 (MY9_2491) comGE 2463468..2463815 (-) 348 WP_014664592.1 competence type IV pilus minor pilin ComGE Machinery gene
  MY9_RS12435 (MY9_2492) comGD 2463799..2464230 (-) 432 WP_014664593.1 competence type IV pilus minor pilin ComGD Machinery gene
  MY9_RS12440 (MY9_2493) comGC 2464220..2464516 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  MY9_RS12445 (MY9_2494) comGB 2464530..2465567 (-) 1038 WP_014664594.1 competence type IV pilus assembly protein ComGB Machinery gene
  MY9_RS12450 (MY9_2495) comGA 2465554..2466624 (-) 1071 WP_041521378.1 competence protein ComGA Machinery gene
  MY9_RS12460 (MY9_2497) - 2466836..2467246 (-) 411 WP_041521379.1 CBS domain-containing protein -
  MY9_RS12465 (MY9_2498) corA 2467309..2468262 (-) 954 WP_014664598.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 115 a.a.        Molecular weight: 13055.93 Da        Isoelectric Point: 4.3481

>NTDB_id=50615 MY9_RS12430 WP_014664592.1 2463468..2463815(-) (comGE) [Bacillus sp. JS]
MWIGSKGFSTIETMSALSLWLFVLLTVVPLWDKLIADENMSESREIGYQMMNESISKYVMTGEGAASKTMTKNNQTYAMT
WEEEGEYQNVCISAAAYKEKSFCLSILQTEWLHAS

Nucleotide


Download         Length: 348 bp        

>NTDB_id=50615 MY9_RS12430 WP_014664592.1 2463468..2463815(-) (comGE) [Bacillus sp. JS]
ATGTGGATAGGAAGTAAAGGTTTTTCTACAATAGAAACAATGTCTGCGCTAAGCCTATGGCTGTTTGTGCTGCTGACAGT
TGTCCCCTTGTGGGACAAGCTGATAGCTGATGAAAATATGTCGGAATCACGAGAAATCGGTTATCAGATGATGAATGAGA
GCATTAGCAAATATGTCATGACTGGTGAAGGAGCCGCGTCAAAAACGATGACAAAGAACAACCAGACCTATGCTATGACG
TGGGAGGAGGAGGGCGAATATCAAAACGTATGCATCTCAGCGGCAGCTTATAAAGAGAAATCATTTTGCCTCAGCATTCT
GCAGACAGAATGGCTACACGCTTCTTAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Bacillus subtilis subsp. subtilis str. 168

89.565

100

0.896

Multiple sequence alignment