Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   MY9_RS12385 Genome accession   NC_017743
Coordinates   2459001..2459174 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus sp. JS     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2454001..2464174
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  MY9_RS12370 (MY9_2479) gcvT 2454799..2455887 (-) 1089 WP_014664583.1 glycine cleavage system aminomethyltransferase GcvT -
  MY9_RS12375 (MY9_2480) - 2456329..2458002 (+) 1674 WP_014664584.1 SNF2-related protein -
  MY9_RS12380 (MY9_2481) - 2458023..2458817 (+) 795 WP_014664585.1 YqhG family protein -
  MY9_RS12385 (MY9_2482) sinI 2459001..2459174 (+) 174 WP_003230187.1 anti-repressor SinI family protein Regulator
  MY9_RS12390 (MY9_2483) sinR 2459208..2459543 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  MY9_RS12395 (MY9_2484) tasA 2459637..2460422 (-) 786 WP_014664586.1 biofilm matrix protein TasA -
  MY9_RS12400 (MY9_2485) - 2460486..2461058 (-) 573 WP_014664587.1 signal peptidase I -
  MY9_RS12405 (MY9_2486) tapA 2461042..2461797 (-) 756 WP_014664588.1 amyloid fiber anchoring/assembly protein TapA -
  MY9_RS12410 (MY9_2487) - 2462069..2462395 (+) 327 WP_014664589.1 YqzG/YhdC family protein -
  MY9_RS12415 (MY9_2488) - 2462436..2462615 (-) 180 WP_014480252.1 YqzE family protein -
  MY9_RS12420 (MY9_2489) comGG 2462687..2463061 (-) 375 WP_014664590.1 competence type IV pilus minor pilin ComGG Machinery gene
  MY9_RS12425 (MY9_2490) comGF 2463062..2463442 (-) 381 WP_014664591.1 competence type IV pilus minor pilin ComGF Machinery gene
  MY9_RS12430 (MY9_2491) comGE 2463468..2463815 (-) 348 WP_014664592.1 competence type IV pilus minor pilin ComGE Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=50611 MY9_RS12385 WP_003230187.1 2459001..2459174(+) (sinI) [Bacillus sp. JS]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=50611 MY9_RS12385 WP_003230187.1 2459001..2459174(+) (sinI) [Bacillus sp. JS]
ATGAAAAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1

Multiple sequence alignment