Detailed information    

insolico Bioinformatically predicted

Overview

Name   comB7   Type   Machinery gene
Locus tag   HCW_RS09530 Genome accession   NC_017737
Coordinates   34965..35081 (-) Length   38 a.a.
NCBI ID   WP_014660212.1    Uniprot ID   -
Organism   Helicobacter cetorum MIT 00-7128     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 29965..40081
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HCW_RS09525 (HCW_00165) - 30738..32147 (-) 1410 WP_014660208.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -
  HCW_RS00170 (HCW_00170) comB10 32187..33320 (-) 1134 WP_014660209.1 DNA type IV secretion system protein ComB10 Machinery gene
  HCW_RS00175 (HCW_00175) comB9 33317..34225 (-) 909 WP_014660210.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HCW_RS00180 (HCW_00180) comB8 34225..34968 (-) 744 WP_014660211.1 type IV secretion system protein Machinery gene
  HCW_RS09530 (HCW_00185) comB7 34965..35081 (-) 117 WP_014660212.1 hypothetical protein Machinery gene
  HCW_RS00185 (HCW_00190) comB6 35104..36153 (-) 1050 WP_014660213.1 NADH-ubiquinone oxidoreductase Machinery gene
  HCW_RS00190 (HCW_00195) - 36165..37157 (-) 993 WP_043902703.1 DUF7488 domain-containing protein -
  HCW_RS00195 (HCW_00200) - 37157..37450 (-) 294 WP_043902704.1 YbaB/EbfC family nucleoid-associated protein -
  HCW_RS00200 (HCW_00205) panD 37461..37814 (-) 354 WP_014660216.1 aspartate 1-decarboxylase -
  HCW_RS00205 (HCW_00210) - 37811..40015 (-) 2205 WP_014660217.1 AAA family ATPase -

Sequence

Protein


Download         Length: 38 a.a.        Molecular weight: 4376.35 Da        Isoelectric Point: 8.5386

>NTDB_id=50482 HCW_RS09530 WP_014660212.1 34965..35081(-) (comB7) [Helicobacter cetorum MIT 00-7128]
MKFFFSMVLLFLMLGCSSKVHEMKKSPCAFYENPLSLA

Nucleotide


Download         Length: 117 bp        

>NTDB_id=50482 HCW_RS09530 WP_014660212.1 34965..35081(-) (comB7) [Helicobacter cetorum MIT 00-7128]
ATGAAATTTTTCTTTAGTATGGTTCTTTTGTTTTTAATGCTTGGTTGCTCCAGCAAGGTGCATGAAATGAAGAAAAGCCC
TTGTGCGTTCTATGAAAACCCACTGAGTCTTGCATGA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

57.895

100

0.579

Multiple sequence alignment