Detailed information    

insolico Bioinformatically predicted

Overview


Name   comB7   Type   Machinery gene
Locus tag   HPB14_RS00210 Genome accession   NC_017733
Coordinates   37400..37513 (+) Length   37 a.a.
NCBI ID   WP_001217873.1    Uniprot ID   G2MCV1
Organism   Helicobacter pylori HUP-B14     
Function   transformation-associated type IV transport system (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 32400..42513
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  HPB14_RS00185 (HPB14_00160) - 32453..34678 (+) 2226 WP_001051468.1 AAA family ATPase -
  HPB14_RS00190 (HPB14_00165) panD 34668..35021 (+) 354 WP_000142235.1 aspartate 1-decarboxylase -
  HPB14_RS00195 (HPB14_00170) - 35024..35326 (+) 303 WP_000347928.1 YbaB/EbfC family nucleoid-associated protein -
  HPB14_RS00200 (HPB14_00175) - 35326..36321 (+) 996 WP_000468427.1 PDZ domain-containing protein -
  HPB14_RS00205 (HPB14_00180) comB6 36329..37384 (+) 1056 WP_000786655.1 P-type conjugative transfer protein TrbL Machinery gene
  HPB14_RS00210 (HPB14_00185) comB7 37400..37513 (+) 114 WP_001217873.1 hypothetical protein Machinery gene
  HPB14_RS00215 (HPB14_00190) comB8 37510..38253 (+) 744 WP_001208391.1 type IV secretion system protein Machinery gene
  HPB14_RS00220 (HPB14_00195) comB9 38253..39272 (+) 1020 WP_014658396.1 TrbG/VirB9 family P-type conjugative transfer protein Machinery gene
  HPB14_RS00225 (HPB14_00200) comB10 39265..40401 (+) 1137 WP_001045836.1 DNA type IV secretion system protein ComB10 Machinery gene
  HPB14_RS00230 (HPB14_00205) - 40471..41883 (+) 1413 WP_000694865.1 mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase -

Sequence


Protein


Download         Length: 37 a.a.        Molecular weight: 4325.25 Da        Isoelectric Point: 9.3572

>NTDB_id=50425 HPB14_RS00210 WP_001217873.1 37400..37513(+) (comB7) [Helicobacter pylori HUP-B14]
MRIFFVIMGLVFFGCTSKVHEMKKSPCTLYENRLNLA

Nucleotide


Download         Length: 114 bp        

>NTDB_id=50425 HPB14_RS00210 WP_001217873.1 37400..37513(+) (comB7) [Helicobacter pylori HUP-B14]
ATGAGAATTTTTTTTGTTATTATGGGACTTGTGTTTTTTGGTTGCACCAGTAAGGTGCATGAGATGAAAAAAAGCCCTTG
CACCTTGTATGAAAACAGGTTAAATCTCGCATGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comB7 Helicobacter pylori P1

100

100

1


Multiple sequence alignment